Anti-Mouse NFIA (KIAA1439) Polyclonal Antibody, Rabbit

Product#: MKA1439AF
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse NFIA (KIAA1439) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MKA0387AF
Quantity 50 µg (250 µL)
Gene :mouse nuclear factor I/A (NFIA) (mNFIA, mKIAA1439)
Immunogen GX2328 (GST-fusion protein, 165 amino acids)
    DEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKEEERAVKDELLSEKPE
    VKQKWASRLLAKLRKDIRPEYREDFVLTVTGKKPPCCVLSNPDQKGKMRRIDCLRQ
    ADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHIGVSVKE
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
:Specific to recombinant protein GX2328. This antibody detects mNFIA protein.
    Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for NFIA Gene

  • Nuclear Factor I A 2 3 5
  • CCAAT-Box-Binding Transcription Factor 3 4
  • Nuclear Factor 1 A-Type 3 4
  • TGGCA-Binding Protein 3 4
  • Nuclear Factor I/A 2 4
  • KIAA1439 2 4
  • NF-I/A 3 4
  • NF1-A 3 4
  • NFI-A 3 4
  • NFI-L 2 3
  • CTF 3 4
  • Nuclear Factor 1/A 4
  • BRMUTD 3
  • NFIA 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X