Anti-Mouse OTUD4 (KIAA1046) Polyclonal Antibody, Rabbit

Product#: MK10460910
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse OTUD4 (KIAA1046) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MK10460910
Quantity 50 µg (250 µL)
Gene mouse OTU domain containing 4 (OTUD4) (mOTUD4, mKIAA1046)
Immunogen GX0383 (GST-fusion protein, 233 amino acids)
    IVLPPDDKGELDLPLENLDLSKECDSVSAVDEFPDARVEGAHSLSAASVSSKHEGRVEQSSQTR
    KADIDLASGSSAVEGKGHPPTQILNREREPGSAEPEPKRTIQSLKEKPEKVKDPKTAADVVSPG
    ANSVDRLQRPKEESSEDENEVSNILRSGRSKQFYNQTYGSRKYKSDWGSSGRGGYQHVRGE
    ESWKGQPNRSRDEGYQYHRHVRGRPYRGDRRRSGMGDGHRGQHT
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
Specific to recombinant protein GX0383. This antibody detects mOTUD4 protein.
    Details are shown in the InGaP database. Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for OTUD4 Gene

  • OTU Deubiquitinase 4 2 3 5
  • OTU Domain-Containing Protein 4 3 4
  • KIAA1046 2 4
  • HSHIN1 2 3
  • DUBA6 2 3
  • HIV-1 Induced Protein HIN-1 3
  • HIV-1-Induced Protein HIN-1 4
  • OTU Domain Containing 4 2
  • EC 3.4.19.12 4
  • OTUD4 5
  • HIN-1 4
  • HIN1 3


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X