Anti-Mouse MORC2A (KIAA0852) Polyclonal Antibody, Rabbit

Product#: FNK-MK08520910

$495.39

Qty:

Availability:

Ships in 24 hours

Anti-Mouse MORC2A (KIAA0852) Polyclonal Antibody, Rabbit

General information

Cat. No.	：FNK-MK08520910
Quantity	：50 µg (250 µL)
Gene	：mouse Influenza virus NS1A binding protein (mMORC2A, mKIAA0852)
Immunogen	：GX1256 (GST-fusion protein, 240 amino acids) KDKGLHVEVRVNREWYTGRVTAVEVGKNAVRWKVKFDYVPTDTTPRDRWVEKGSEDVRLMK PPSPEHQSPDTQQEGGEEEEAMVARQAVALPEPSTSDGLPIEPDTTATSPSHETIDLLVQILRN CLRYFLPPSFPISKKELSVMNSEELISFPLKEYFKQYEVGLQNLCHSYQSRADSRAKASEESLRT SEKKLRETEEKLQKLRTNIVALLQKVQEDIDINTDDELDAYIEDLITKGD
Format	：Affinity Purified Rabbit IgG
Constitution	：PBS containing with 50% glycerol and 0.02% of NaN₃
Antigen Species	：Mouse
Host Species	：Rabbit
Label	：Unlabeled
Cross Reactivity	：Human/ Mouse
Application	：Western blotting (1 : 1,000), Other applications have not been tested.
Specificity	：Specific to recombinant protein GX1256. This antibody detects mMORC2A protein. It also recognizes human MORC2A protein. Details are shown in the InGaP database. Other species have not been tested.
Long Term Storage	：-20°C or below
Shipping Condition	：Dry Ice

Antigen Characterization

Human Diseases

Charcot-Marie-Tooth disease type 2Z (CMT2Z): Mutations in MORC2 lead to peripheral neuropathy and central nervous system involvement, characterized by axonal degeneration and cognitive impairments.
Breast Cancer: High levels of MORC2 are associated with poor prognosis and resistance to DNA-damaging chemotherapy.
Neuronal Apoptosis: Involved in neuronal DNA damage leading to apoptosis, particularly in conditions like CMT2Z

Cellular Signaling Pathways

Involved in DNA damage response (DDR): MORC2 plays a role in chromatin remodeling and the recruitment of DNA repair proteins.
Adipogenesis and Lipogenesis: Functions in lipid metabolism and cellular differentiation processes.
Transcriptional regulation: Acts as a transcriptional repressor influencing gene expression related to stress responses and cell cycle regulation

Aliases for MORC2A Gene

References

Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Xie, Hong-Yan, et al. “Dimerization of MORC2 through Its C-Terminal Coiled-Coil Domain Enhances Chromatin Dynamics and Promotes DNA Repair - Cell Communication and Signaling.” BioMed Central, BioMed Central, 3 Dec. 2019, biosignaling.biomedcentral.com/articles/10.1186/s12964-019-0477-5.
Lee, Geon Seong, et al. “Morc2a P.S87L Mutant Mice Develop Peripheral and Central Neuropathies Associated with Neuronal DNA Damage and Apoptosis.” Disease Models & Mechanisms, U.S. National Library of Medicine, 1 Oct. 2021, www.ncbi.nlm.nih.gov/pmc/articles/PMC8560500/.
Wang, Huan, et al. “MORC Protein Family-Related Signature within Human Disease and Cancer.” Nature News, Nature Publishing Group, 27 Nov. 2021, www.nature.com/articles/s41419-021-04393-1.
Morc2a Microrchidia 2A [Mus Musculus (House Mouse)] - Gene - NCBI.” National Center for Biotechnology Information, U.S. National Library of Medicine, www.ncbi.nlm.nih.gov/gene?Cmd=DetailsSearch&Db=gene&Term=74522.