Anti-Mouse MEF2D (KIBB0022) Polyclonal Antibody, Rabbit
Product#: FNK-MKB0022AF
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Mouse MEF2D (KIBB0022) Polyclonal Antibody, Rabbit
General information
| Cat. No. | ：FNK-MKB0022AF |
| Quantity | ：50 µg (250 µL) |
| Gene | ：mouse myocyte enhancer factor 2D (MEF2D) (mMEF2D, mKIBB0022) |
| Immunogen | ：GX2868 (GST-fusion protein, 168 amino acids) MDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYR RASEELDGLFRRYGSSVPAPNFAMPVTVPVSNQSSMQFSNPSSSLVTPSLVTSSLT DPRLLSPQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSA R |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Human/ Mouse |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX2868. This antibody detects mMEF2D protein.
Other species have not been tested. |
| Long Term Storage | ：-20°C or below |
| Shipping Condition | ：Dry Ice |
Antigen Characterization
- Type: Primary
- Application: Western Blot (WB),ELISA,Immunohistochemistry (IHC),Immunofluorescence (IF)
- Species: Human, Mouse
- Recombinant: Yes
Human Diseases
- B-cell Acute Lymphoblastic Leukemia (B-ALL): MEF2D is overexpressed and contributes to tumor progression and poor prognosis. Its knockdown has been shown to inhibit cell viability and induce apoptosis in B-ALL cells.
- Hepatocellular Carcinoma (HCC): MEF2D promotes invasion and metastasis of cancer cells.
- Colorectal Cancer: Involved in enhancing cancer cell invasion and is associated with poor clinical outcomes.
- Nasal Type Extranodal NK/T-cell Lymphoma: Associated with the pathogenesis of this lymphoma type.
Cellular Signaling Pathways
- PI3K-AKT Pathway: MEF2D influences this pathway, which is critical for cell survival and proliferation, particularly in B-ALL.
- MAPK Signaling Pathway: Implicated in various cellular responses including growth, differentiation, and apoptosis.
- Calcium Signaling Pathway: MEF2D plays a role in calcium-dependent processes, affecting neuronal differentiation and muscle formation.
- Wnt Signaling Pathway: Involved in regulating gene expression during development and cancer progression.
Aliases for MEF2D Gene
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
- Chang, Ning, et al. “Knockdown of MEF2D Inhibits the Development and Progression of B-Cell Acute Lymphoblastic Leukemia.” Translational Cancer Research, AME Publishing Company, 1 Feb. 2023, tcr.amegroups.org/article/view/71979/html.
- Di Giorgio, Eros, et al. “A Biological Circuit Involving MEF2C, MEF2D, and HDAC9 Controls the Immunosuppressive Functions of Cd4+foxp3+ T-Regulatory Cells.” Frontiers, Frontiers, 9 June 2021, www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2021.703632/full.
- Chen, Xiao, et al. “MEF2 Signaling and Human Diseases.” Oncotarget, U.S. National Library of Medicine, 4 Dec. 2017, www.ncbi.nlm.nih.gov/pmc/articles/PMC5762387/.
- 14353-1-AP.” MEF2D Antibody (14353-1-AP) | Proteintech, 31 Aug. 2024, www.ptglab.com/products/MEF2D-Antibody-14353-1-AP.htm.
- Kim, Ye-Ji, et al. “The Transcription Factor Mef2d Regulates b:T Synapse-Dependent GC-Tfh Differentiation and Il-21-Mediated Humoral Immunity.” Science Immunology, U.S. National Library of Medicine, 31 Mar. 2023, www.ncbi.nlm.nih.gov/pmc/articles/PMC10311795/.
- Account - Genecards Suite, www.genecards.org/cgi-bin/carddisp.pl?gene=MEF2D.
