Anti-Mouse MEF2D (KIBB0022) Polyclonal Antibody, Rabbit

Product#: FNK-MKB0022AF
$495.39
Availability:
Ships in 1-2 Weeks

Anti-Mouse MEF2D (KIBB0022) Polyclonal Antibody, Rabbit


General information 

Cat. No. :FNK-MKB0022AF
Quantity :50 µg (250 µL)
Gene :mouse myocyte enhancer factor 2D (MEF2D) (mMEF2D, mKIBB0022)
Immunogen :GX2868 (GST-fusion protein, 168 amino acids)
    MDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYR
    RASEELDGLFRRYGSSVPAPNFAMPVTVPVSNQSSMQFSNPSSSLVTPSLVTSSLT
    DPRLLSPQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSA
    R
Format :Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species :Rabbit 
Label :Unlabeled
Cross Reactivity :Human/ Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
:Specific to recombinant protein GX2868. This antibody detects mMEF2D protein.
    Other species have not been tested.
Long Term Storage :-20°C or below 
Shipping Condition :Dry Ice 
 

Antigen Characterization 

  • Type: Primary
  • Application: Western Blot (WB),ELISA,Immunohistochemistry (IHC),Immunofluorescence (IF)
  • Species: Human, Mouse
  • Recombinant: Yes


Human Diseases

  • B-cell Acute Lymphoblastic Leukemia (B-ALL): MEF2D is overexpressed and contributes to tumor progression and poor prognosis. Its knockdown has been shown to inhibit cell viability and induce apoptosis in B-ALL cells.
  • Hepatocellular Carcinoma (HCC): MEF2D promotes invasion and metastasis of cancer cells.
  • Colorectal Cancer: Involved in enhancing cancer cell invasion and is associated with poor clinical outcomes.
  • Nasal Type Extranodal NK/T-cell Lymphoma: Associated with the pathogenesis of this lymphoma type.


Cellular Signaling Pathways

  • PI3K-AKT Pathway: MEF2D influences this pathway, which is critical for cell survival and proliferation, particularly in B-ALL.
  • MAPK Signaling Pathway: Implicated in various cellular responses including growth, differentiation, and apoptosis.
  • Calcium Signaling Pathway: MEF2D plays a role in calcium-dependent processes, affecting neuronal differentiation and muscle formation.
  • Wnt Signaling Pathway: Involved in regulating gene expression during development and cancer progression.


Aliases for MEF2D Gene

  • Myocyte Enhancer Factor 2D 2 3 5
  • Myocyte-Specific Enhancer Factor 2D 3 4
  • MADS Box Transcription Enhancer Factor 2, Polypeptide D 3
  • MEF2D 5


References 

  • Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
  • Chang, Ning, et al. “Knockdown of MEF2D Inhibits the Development and Progression of B-Cell Acute Lymphoblastic Leukemia.” Translational Cancer Research, AME Publishing Company, 1 Feb. 2023, tcr.amegroups.org/article/view/71979/html. 
  • Di Giorgio, Eros, et al. “A Biological Circuit Involving MEF2C, MEF2D, and HDAC9 Controls the Immunosuppressive Functions of Cd4+foxp3+ T-Regulatory Cells.” Frontiers, Frontiers, 9 June 2021, www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2021.703632/full. 
  • Chen, Xiao, et al. “MEF2 Signaling and Human Diseases.” Oncotarget, U.S. National Library of Medicine, 4 Dec. 2017, www.ncbi.nlm.nih.gov/pmc/articles/PMC5762387/. 
  • 14353-1-AP.” MEF2D Antibody (14353-1-AP) | Proteintech, 31 Aug. 2024, www.ptglab.com/products/MEF2D-Antibody-14353-1-AP.htm. 
  • Kim, Ye-Ji, et al. “The Transcription Factor Mef2d Regulates b:T Synapse-Dependent GC-Tfh Differentiation and Il-21-Mediated Humoral Immunity.” Science Immunology, U.S. National Library of Medicine, 31 Mar. 2023, www.ncbi.nlm.nih.gov/pmc/articles/PMC10311795/. 
  • Account - Genecards Suite, www.genecards.org/cgi-bin/carddisp.pl?gene=MEF2D. 

Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X