Anti-Mouse MYST4 (KIAA0383) Polyclonal Antibody, Rabbit
General information
| Cat. No. |
:FNK-MKA0383AF |
| Quantity |
:50 µg (250 µL) |
| Gene |
:mouse MYST histone acetyltransferase (monocytic leukemia) 4 (MYST4) (mMYST4, mKIAA0383) |
| Immunogen |
:GX1056 (GST-fusion protein, 159 amino acids)
QLELSVQDGSVLKVTNKGLASYKDPDNPGRFSSVKPGTFPKPTKGSKGPPCNDLRNVDWNKL
LKRAIEGLEEPNGSSLKNIEKYLRSQSDLTGTTNHPAFQQRLRLGAKRAVNNGRLLKEGPQYRV
NSGSSDGKGAPQYPSAFPSSLPPVSLLPHEKDQ |
| Format |
:Affinity Purified Rabbit IgG |
| Constitution |
:PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species |
:Mouse |
| Host Species |
:Rabbit |
| Label |
:Unlabeled |
| Cross Reactivity |
:Mouse |
| Application |
:Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
:Specific to recombinant protein GX1056. This antibody detects mMYST4 protein.
Other species have not been tested.
|
| Long Term Storage |
:-20°C or below |
| Shipping Condition |
:Dry Ice |
Antigen Characterization
- Type: Primary
- Application: ELISA,Western Blot,Immunohistochemistry
- Species: Human
- Recombinant: Yes
Human Diseases
- Cancer: Overexpression of MYST4 is linked to various cancers, particularly ovarian high-grade serous carcinomas (HGSCs) and hepatocellular carcinoma (HCC), correlating with poor patient survival rates.
- Developmental Disorders: Mutations in MYST4 are associated with several syndromes, including Noonan syndrome-like disorder, Ohdo syndrome, genitopatellar syndrome, and blepharophimosis-ptosis-epicanthus inversus syndrome.
- Acute Myeloid Leukemia (AML): The MYST4 gene can fuse with the CBP gene due to chromosomal translocation, contributing to AML.
Cellular Signaling Pathways
- RAS/MAPK Pathway: MYST4 regulates this pathway, influencing cellular growth and tumorigenesis.
- Acetylation of Non-Histone Proteins: MYST4 modifies various proteins involved in critical cellular processes, including transcription regulation and DNA damage response.
- T-Cell Signaling: MYST4 plays a role in T-cell activation and function through post-translational modifications that affect signaling cascades.
Aliases for MYST4 Gene
- Lysine Acetyltransferase 6B 2 3 5
- MOZ2 2 3 4
- MYST Histone Acetyltransferase (Monocytic Leukemia) 4 2 3
- Monocytic Leukemia Zinc Finger Protein-Related Factor 3 4
- MOZ, YBF2/SAS3, SAS2 And TIP60 Protein 4 3 4
- Histone Acetyltransferase KAT6B 3 4
- K(Lysine) Acetyltransferase 6B 2 3
- Histone Acetyltransferase MOZ2 3 4
- MOZ-Related Factor 2 3
- Querkopf 2 3
- ZC2HC6B 2 3
- MYST-4 3 4
- MYST4 3 4
- MORF 3 4
- Qkf 2 3
- Histone Acetyltransferase MYST4 3
- Histone Acetyltransferase MORF 3
- EC 2.3.1.48 4
- KIAA0383 4
- GTPTS 3
- KAT6B 5
- Morf 2
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
- Liu, Chao-Lien, et al. “The Overexpression of Myst4 in Human Solid Tumors Is Associated with Increased Aggressiveness and Decreased Overall Survival.” International Journal of Clinical and Experimental Pathology, U.S. National Library of Medicine, 1 Feb. 2019, www.ncbi.nlm.nih.gov/pmc/articles/PMC6945101/.
- Sapountzi, Vasileia, and Jacques Côté. “Myst-Family Histone Acetyltransferases: Beyond Chromatin.” Cellular and Molecular Life Sciences : CMLS, U.S. National Library of Medicine, Apr. 2011, www.ncbi.nlm.nih.gov/pmc/articles/PMC11114825/.
- Kraft, Michael, et al. “Disruption of the Histone Acetyltransferase MYST4 Leads to a Noonan Syndrome–like Phenotype and Hyperactivated MAPK Signaling in Humans and Mice.” The Journal of Clinical Investigation, American Society for Clinical Investigation, 1 Sept. 2011, www.jci.org/articles/view/43428.
- Myst4 Elisa Kit: Human Myst Histone Acetyltransferase (Monocytic Leukemia) 4 Elisa Kit-NP_001243397.1.” Main Menu, www.mybiosource.com/myst4-human-elisa-kits/myst-histone-acetyltransferase-monocytic-leukemia-4/9332448.
- Myst4 Antibody - N-Terminal Region : HRP (ARP38985_P050-HRP).” Aviva Systems Biology, www.avivasysbio.com/myst4-antibody-n-terminal-region-hrp-arp38985-p050-hrp.html.
- Abnova Human MYST4 Partial ORF (NP_036462, 80 A.A. - 172 A.A.) Recombinant Protein with GST-Tag at N-Terminal - Recombinant Proteins.” Fisher Scientific - Part of Thermo Fisher Scientific, www.fishersci.pt/shop/products/human-myst4-partial-orf-np-036462-80-a-a-172-a-a-recombinant-protein-gst-tag-at-n-terminal-abnova/16177392.
