/Content/Upload/Product/MKA0383AF_fig1_1200.png

Anti-Mouse MYST4 (KIAA0383) Polyclonal Antibody, Rabbit

Product#: FNK-MKA0383AF

$495.39

Qty:

Availability:

Ships in 1-2 Weeks

Anti-Mouse MYST4 (KIAA0383) Polyclonal Antibody, Rabbit

General information

Cat. No.	：FNK-MKA0383AF
Quantity	：50 µg (250 µL)
Gene	：mouse MYST histone acetyltransferase (monocytic leukemia) 4 (MYST4) (mMYST4, mKIAA0383)
Immunogen	：GX1056 (GST-fusion protein, 159 amino acids) QLELSVQDGSVLKVTNKGLASYKDPDNPGRFSSVKPGTFPKPTKGSKGPPCNDLRNVDWNKL LKRAIEGLEEPNGSSLKNIEKYLRSQSDLTGTTNHPAFQQRLRLGAKRAVNNGRLLKEGPQYRV NSGSSDGKGAPQYPSAFPSSLPPVSLLPHEKDQ
Format	：Affinity Purified Rabbit IgG
Constitution	：PBS containing with 50% glycerol and 0.02% of NaN₃
Antigen Species	：Mouse
Host Species	：Rabbit
Label	：Unlabeled
Cross Reactivity	：Mouse
Application	：Western blotting (1 : 1,000), Other applications have not been tested.
Specificity	：Specific to recombinant protein GX1056. This antibody detects mMYST4 protein. Other species have not been tested.
Long Term Storage	：-20°C or below
Shipping Condition	：Dry Ice

Antigen Characterization

Type: Primary
Application: ELISA,Western Blot,Immunohistochemistry
Species: Human
Recombinant: Yes

Human Diseases

Cancer: Overexpression of MYST4 is linked to various cancers, particularly ovarian high-grade serous carcinomas (HGSCs) and hepatocellular carcinoma (HCC), correlating with poor patient survival rates.
Developmental Disorders: Mutations in MYST4 are associated with several syndromes, including Noonan syndrome-like disorder, Ohdo syndrome, genitopatellar syndrome, and blepharophimosis-ptosis-epicanthus inversus syndrome.
Acute Myeloid Leukemia (AML): The MYST4 gene can fuse with the CBP gene due to chromosomal translocation, contributing to AML.

Cellular Signaling Pathways

RAS/MAPK Pathway: MYST4 regulates this pathway, influencing cellular growth and tumorigenesis.
Acetylation of Non-Histone Proteins: MYST4 modifies various proteins involved in critical cellular processes, including transcription regulation and DNA damage response.
T-Cell Signaling: MYST4 plays a role in T-cell activation and function through post-translational modifications that affect signaling cascades.

Aliases for MYST4 Gene

Lysine Acetyltransferase 6B ²³⁵
MOZ2 ²³⁴
MYST Histone Acetyltransferase (Monocytic Leukemia) 4 ²³
Monocytic Leukemia Zinc Finger Protein-Related Factor ³⁴
MOZ, YBF2/SAS3, SAS2 And TIP60 Protein 4 ³⁴
Histone Acetyltransferase KAT6B ³⁴
K(Lysine) Acetyltransferase 6B ²³
Histone Acetyltransferase MOZ2 ³⁴
MOZ-Related Factor ²³
Querkopf ²³
ZC2HC6B ²³
MYST-4 ³⁴
MYST4 ³⁴
MORF ³⁴
Qkf ²³
Histone Acetyltransferase MYST4 ³
Histone Acetyltransferase MORF ³
EC 2.3.1.48 ⁴
KIAA0383 ⁴
GTPTS ³
KAT6B ⁵
Morf ²

References

Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Liu, Chao-Lien, et al. “The Overexpression of Myst4 in Human Solid Tumors Is Associated with Increased Aggressiveness and Decreased Overall Survival.” International Journal of Clinical and Experimental Pathology, U.S. National Library of Medicine, 1 Feb. 2019, www.ncbi.nlm.nih.gov/pmc/articles/PMC6945101/.
Sapountzi, Vasileia, and Jacques Côté. “Myst-Family Histone Acetyltransferases: Beyond Chromatin.” Cellular and Molecular Life Sciences : CMLS, U.S. National Library of Medicine, Apr. 2011, www.ncbi.nlm.nih.gov/pmc/articles/PMC11114825/.
Kraft, Michael, et al. “Disruption of the Histone Acetyltransferase MYST4 Leads to a Noonan Syndrome–like Phenotype and Hyperactivated MAPK Signaling in Humans and Mice.” The Journal of Clinical Investigation, American Society for Clinical Investigation, 1 Sept. 2011, www.jci.org/articles/view/43428.
Myst4 Elisa Kit: Human Myst Histone Acetyltransferase (Monocytic Leukemia) 4 Elisa Kit-NP_001243397.1.” Main Menu, www.mybiosource.com/myst4-human-elisa-kits/myst-histone-acetyltransferase-monocytic-leukemia-4/9332448.
Myst4 Antibody - N-Terminal Region : HRP (ARP38985_P050-HRP).” Aviva Systems Biology, www.avivasysbio.com/myst4-antibody-n-terminal-region-hrp-arp38985-p050-hrp.html.
Abnova Human MYST4 Partial ORF (NP_036462, 80 A.A. - 172 A.A.) Recombinant Protein with GST-Tag at N-Terminal - Recombinant Proteins.” Fisher Scientific - Part of Thermo Fisher Scientific, www.fishersci.pt/shop/products/human-myst4-partial-orf-np-036462-80-a-a-172-a-a-recombinant-protein-gst-tag-at-n-terminal-abnova/16177392.