Anti-Mouse MYST4 (KIAA0383) Polyclonal Antibody, Rabbit

Product#: FNK-MKA0383AF
$495.39
Availability:
Ships in 1-2 Weeks

Anti-Mouse MYST4 (KIAA0383) Polyclonal Antibody, Rabbit


General information 

Cat. No. :FNK-MKA0383AF
Quantity :50 µg (250 µL)
Gene :mouse MYST histone acetyltransferase (monocytic leukemia) 4 (MYST4) (mMYST4, mKIAA0383)
Immunogen :GX1056 (GST-fusion protein, 159 amino acids)
    QLELSVQDGSVLKVTNKGLASYKDPDNPGRFSSVKPGTFPKPTKGSKGPPCNDLRNVDWNKL
    LKRAIEGLEEPNGSSLKNIEKYLRSQSDLTGTTNHPAFQQRLRLGAKRAVNNGRLLKEGPQYRV
    NSGSSDGKGAPQYPSAFPSSLPPVSLLPHEKDQ
Format :Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species :Rabbit 
Label :Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
:Specific to recombinant protein GX1056. This antibody detects mMYST4 protein.
    Other species have not been tested.
Long Term Storage :-20°C or below 
Shipping Condition  :Dry Ice 
 

Antigen Characterization 

  • Type: Primary
  • Application: ELISA,Western Blot,Immunohistochemistry
  • Species: Human
  • Recombinant: Yes


Human Diseases

  • Cancer: Overexpression of MYST4 is linked to various cancers, particularly ovarian high-grade serous carcinomas (HGSCs) and hepatocellular carcinoma (HCC), correlating with poor patient survival rates.
  • Developmental Disorders: Mutations in MYST4 are associated with several syndromes, including Noonan syndrome-like disorder, Ohdo syndrome, genitopatellar syndrome, and blepharophimosis-ptosis-epicanthus inversus syndrome.
  • Acute Myeloid Leukemia (AML): The MYST4 gene can fuse with the CBP gene due to chromosomal translocation, contributing to AML.


Cellular Signaling Pathways

  • RAS/MAPK Pathway: MYST4 regulates this pathway, influencing cellular growth and tumorigenesis.
  • Acetylation of Non-Histone Proteins: MYST4 modifies various proteins involved in critical cellular processes, including transcription regulation and DNA damage response.
  • T-Cell Signaling: MYST4 plays a role in T-cell activation and function through post-translational modifications that affect signaling cascades.

 

Aliases for MYST4 Gene

  • Lysine Acetyltransferase 6B 2 3 5
  • MOZ2 2 3 4
  • MYST Histone Acetyltransferase (Monocytic Leukemia) 4 2 3
  • Monocytic Leukemia Zinc Finger Protein-Related Factor 3 4
  • MOZ, YBF2/SAS3, SAS2 And TIP60 Protein 4 3 4
  • Histone Acetyltransferase KAT6B 3 4
  • K(Lysine) Acetyltransferase 6B 2 3
  • Histone Acetyltransferase MOZ2 3 4
  • MOZ-Related Factor 2 3
  • Querkopf 2 3
  • ZC2HC6B 2 3
  • MYST-4 3 4
  • MYST4 3 4
  • MORF 3 4
  • Qkf 2 3
  • Histone Acetyltransferase MYST4 3
  • Histone Acetyltransferase MORF 3
  • EC 2.3.1.48 4
  • KIAA0383 4
  • GTPTS 3
  • KAT6B 5
  • Morf 2


References 

  • Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
  • Liu, Chao-Lien, et al. “The Overexpression of Myst4 in Human Solid Tumors Is Associated with Increased Aggressiveness and Decreased Overall Survival.” International Journal of Clinical and Experimental Pathology, U.S. National Library of Medicine, 1 Feb. 2019, www.ncbi.nlm.nih.gov/pmc/articles/PMC6945101/. 
  • Sapountzi, Vasileia, and Jacques Côté. “Myst-Family Histone Acetyltransferases: Beyond Chromatin.” Cellular and Molecular Life Sciences : CMLS, U.S. National Library of Medicine, Apr. 2011, www.ncbi.nlm.nih.gov/pmc/articles/PMC11114825/. 
  • Kraft, Michael, et al. “Disruption of the Histone Acetyltransferase MYST4 Leads to a Noonan Syndrome–like Phenotype and Hyperactivated MAPK Signaling in Humans and Mice.” The Journal of Clinical Investigation, American Society for Clinical Investigation, 1 Sept. 2011, www.jci.org/articles/view/43428. 
  • Myst4 Elisa Kit: Human Myst Histone Acetyltransferase (Monocytic Leukemia) 4 Elisa Kit-NP_001243397.1.” Main Menu, www.mybiosource.com/myst4-human-elisa-kits/myst-histone-acetyltransferase-monocytic-leukemia-4/9332448. 
  • Myst4 Antibody - N-Terminal Region : HRP (ARP38985_P050-HRP).” Aviva Systems Biology, www.avivasysbio.com/myst4-antibody-n-terminal-region-hrp-arp38985-p050-hrp.html.
  • Abnova Human MYST4 Partial ORF (NP_036462, 80 A.A. - 172 A.A.) Recombinant Protein with GST-Tag at N-Terminal - Recombinant Proteins.” Fisher Scientific - Part of Thermo Fisher Scientific, www.fishersci.pt/shop/products/human-myst4-partial-orf-np-036462-80-a-a-172-a-a-recombinant-protein-gst-tag-at-n-terminal-abnova/16177392. 

Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X