Anti-Mouse MICAL2 (KIAA0750) Polyclonal Antibody, Rabbit

Product#: FNK-MKA0750AF

$495.39

Qty:

Availability:

Ships in 1-2 Weeks

Anti-Mouse MICAL2 (KIAA0750) Polyclonal Antibody, Rabbit

General information

Cat. No.	：FNK-MKA0750AF
Quantity	：50 µg (250 µL)
Gene	：mouse microtubule associated monoxygenase, calponin and LIM domain containing 2 (mMICAL2, mKIAA0750)
Immunogen	：GX2518 (GST-fusion protein, 168 amino acids) SGIGAAAEVLVNLYLNDHRPKTQATSPDLESPRKAFPLSLGGRDTCYFCKKRVYMIERLSAEGH FFHQECFRCSVCSATLRLAAYAFDCDEGKFYCKPHFVHCKTSSKQRKRRAELNQQREEEGTW QEQEAPRRDVPTESSCAVAAISTPEGSPPVRFSLPVLHPLLG
Format	：Affinity Purified Rabbit IgG
Constitution	：PBS containing with 50% glycerol and 0.02% of NaN₃
Antigen Species	：Mouse
Host Species	：Rabbit
Label	：Unlabeled
Cross Reactivity	：Human/ Mouse
Application	：Western blotting (1 : 1,000), Other applications have not been tested.
Specificity	：Specific to recombinant protein GX2518. This antibody detects mMICAL2 protein. It also recognizes human MICAL2 protein. Other species have not been tested.
Long Term Storage	：-20°C or below
Shipping Condition	：Dry Ice

Antigen Characterization

Human Diseases

Pancreatic Cancer: MICAL2 is overexpressed in pancreatic cancer tissues, correlating with poor prognosis and tumor progression. It contributes to epithelial-mesenchymal transition (EMT) and immune evasion by promoting cancer-associated fibroblast (CAF) activity and M2 macrophage infiltration, leading to an immunosuppressive microenvironment.
Gastric Cancer: Involved in promoting cell migration through the activation of MRTF-A and CDC42 signaling pathways.
Prostate Cancer: Linked to aggressive disease and higher Gleason scores, indicating its role in cancer progression.
Muscular Dystrophies: Implicated in muscle regeneration and differentiation processes, affecting myogenic lineage commitmen

Cellular Signaling Pathways

KRAS Signaling Pathway: MICAL2 upregulates KRAS, which is critical for cell growth and survival in several cancers, particularly pancreatic cancer.
MRTF-A Pathway: MICAL2 enhances the nuclear translocation of MRTF-A, which regulates cytoskeletal dynamics and promotes cell migration in response to growth factors like EGF.
ROS Generation: MICAL2 is involved in reactive oxygen species (ROS) production, influencing various signaling pathways related to cell migration and invasion.
VEGF Response: Essential for endothelial cell viability and motility, influencing angiogenesis through VEGF signaling

Aliases for MICAL2 Gene

References

Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Garg, Bharti, et al. “MICAL2 Is a Super Enhancer Associated Gene That Promotes Pancreatic Cancer Growth and Metastasis.” bioRxiv, Cold Spring Harbor Laboratory, 1 Jan. 2024, www.biorxiv.org/content/10.1101/2024.06.26.600548v1.full.
Liu, Zhicheng, et al. “MICAL2 Implies Immunosuppressive Features and Acts as an Independent and Adverse Prognostic Biomarker in Pancreatic Cancer.” Nature News, Nature Publishing Group, 7 Feb. 2024, www.nature.com/articles/s41598-024-52729-6.
Giarratana, Nefele, et al. “MICAL2 Is Essential for Myogenic Lineage Commitment.” Nature News, Nature Publishing Group, 18 Aug. 2020, www.nature.com/articles/s41419-020-02886-z.
Wang, Yueyuan, et al. “MICAL2 Facilitates Gastric Cancer Cell Migration via MRTF-a-Mediated Cdc42 Activation.” Frontiers, Frontiers, 23 Feb. 2021, www.frontiersin.org/journals/molecular-biosciences/articles/10.3389/fmolb.2021.568868/full.
MICAL2 Microtubule Associated Monooxygenase, Calponin and LIM Domain Containing 2 [Mus Musculus (House Mouse)] - Gene - NCBI.” National Center for Biotechnology Information, U.S. National Library of Medicine, www.ncbi.nlm.nih.gov/gene?Cmd=DetailsSearch&Db=gene&Term=320878.