Anti-Mouse HIC2 (KIAA1020) Polyclonal Antibody, Rabbit

Product#: MKA1020AF
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse HIC2 (KIAA1020) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MKA1020AF
Quantity 50 µg (250 µL)
Gene :mouse hypermethylated in cancer 2 (mHIC2, mKIAA1020)
Immunogen GX1352 (GST-fusion protein, 115 amino acids)
    DSRPFKCSVCEKTYKDPATLRQHEKTHWLTRPFPCNICGKMFTQRGTMTRHMRSHLGLKPFA
    CDECGMRFTRQYRLTEHMRVHSGEKPYECQLCGGKFTQQRNLISHLRMHTSPS
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Human/ Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
Specific to recombinant protein GX1352. This antibody detects mHIC2 protein. It also recognizes
    human HIC2 protein. Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for HIC2 Gene

  • HIC ZBTB Transcriptional Repressor 2 2 3 5
  • ZBTB30 2 3 4
  • HRG22 2 3 4
  • Zinc Finger And BTB Domain-Containing Protein 30 3 4
  • HIC1-Related Gene On Chromosome 22 Protein 3 4
  • Hypermethylated In Cancer 2 Protein 3 4
  • KIAA1020 2 4
  • ZNF907 2 3
  • Hic-2 3 4
  • Hic-3 3 4
  • Hypermethylated In Cancer 2 2
  • HIC2 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X