Anti-Mouse KIF26A (KIAA1236) Polyclonal Antibody, Rabbit

Product#: MKA1236AF
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse KIF26A (KIAA1236) Polyclonal Antibody, Rabbit


General information 

Cat. No. MKA1236AF
Quantity 50 µg (250 µL)
Gene mouse kinesin family member 26A (KIF26A) (mKIF26A, mKIAA1236)
Immunogen GX0835 (GST-fusion protein, 187 amino acids)
    TGLQRRRLIPAPLPDAAALGRKPSLPGQWVDLPPPLAGSLKEPFEIKVYEIDDVERLQ
    RHRLPLRENEAKPSQDVEKGPVCISSKLRLAERRQQRLQEVQAKRDHLCEELAETQ
    GRLMVEPGRWLEQFEVDPELEPESAEYLVALEQATAALEQCVNLCKAHVMMVTCF
    DIGVAATTAVPGPQEVDV
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
Specific to recombinant protein GX0835. This antibody detects mKIF26A protein.
    Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for KIF26A Gene

  • Kinesin Family Member 26A 2 3 5
  • Kinesin-Like Protein KIF26A 3 4
  • KIAA1236 2 4
  • KIF26A Variant Protein 3
  • DKFZP434N178 2
  • KIF26A 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X