Anti-Mouse ISLR2 (KIAA1465) Polyclonal Antibody, Rabbit
General information
| Cat. No. |
:FNK-MK14650310 |
| Quantity |
:100 µg (200 µL) |
| Gene |
:mouse immunoglobulin superfamily containing leucine-rich repeat 2 (mISLR2, mKIAA1465) |
| Immunogen |
:GX0968 (GST-fusion protein, 145 amino acids)
LVLATVPLLGAACCHLLAKHPGKPYRLILRPQAPDPMEKRIAADFDPRASYLESEKSYPARGEA
GGEEPEEVPEEGLDEDVEQGDPSGDLQREESLAGCSLVESQSKANQEEFEAGSEYSDRLPLG
AEAVNIAQEINGNYRQTAG |
| Format |
:Rabbit IgG purified with Protein A affinity chromatography |
| Constitution |
:PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species |
:Mouse |
| Host Species |
:Rabbit |
| Label |
:Unlabeled |
| Cross Reactivity |
:Mouse |
| Application |
:Western blotting (1 : 1,000), Immunoprecipitation, Immunohistochemistry.
Other applications have not been tested. |
| Specificity |
:Specific to recombinant protein GX0968. This antibody detects endogenous mISLR2 protein in several
tissues and cells. Details are shown in the InGaP database. Other species have not been tested.
|
| Storage |
:Store at -20°C. Avoid freeze-thaw cycles. |
Anti-Mouse ISLR2 (KIAA1465)

Western blot analysis
- Adult Mouse Tissues -
- 1:Heart, 2:Lung, 3:Liver, 4:Muscle, 5:Kidney, 6:Testis, 7:Pancreas, 8:Thymus, 9:Spleen, 10:Brain, 11:Prostate.
- Cell Lines -
- 12:B16 cells, 13:F9 cells, 14:Neuro2A cells.
References
- Hara, Y. et al.: DNA Res., 10, 129 (2003).
- Koga, H. et al.: DNA Res., 11, 293 (2004).
Aliases for ISLR2 Gene
- Immunoglobulin Superfamily Containing Leucine Rich Repeat 2 2 3 5
- Leucine-Rich Repeat Domain And Immunoglobulin Domain-Containing Axon Extension Protein 3 4
- Immunoglobulin Superfamily Containing Leucine-Rich Repeat Protein 2 3 4
- KIAA1465 2 4
- LINX 3 4
- ISLR2 5