Anti-Mouse KIAA0562 Polyclonal Antibody, Rabbit

Product#: MKA0562AF
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse KIAA0562 Polyclonal Antibody, Rabbit


General information 

Cat. No. :MKA0562AF
Quantity 50 µg (250 µL)
Gene :mouse KIAA0562 (mKIAA0562)
Immunogen GX0935 (GST-fusion protein, 171 amino acids)
    IFCGERNESFTEEGLDLHYWKHCLMLTRCDHCRQVVEISSLTEHLLTECDRRDGFG
    KCPRCSEAIPKEELPGHIKTKECSPAKPEKVANHCPLCHENFAPGEEAWKVHLMGP
    AGCTMNLRKTHVLYKATAPQQGKGPAAAKSSTSAPKVGSKIPTPKGGLSKSSSRTY
    MRR
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Human/ Mouse 
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
Specific to recombinant protein GX0935. This antibody detects mKIAA0562 protein. It also recognizes
    human KIAA0562 protein.    Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for CEP104 Gene

  • Centrosomal Protein 104 2 3 5
  • KIAA0562 2 3 4
  • Centrosomal Protein Of 104 KDa 3 4
  • Centrosomal Protein 104kDa 2 3
  • CFAP256 2 3
  • JBTS25 2 3
  • GlyBP 2 3
  • ROC22 2 3
  • Glycine, Glutamate, Thienylcyclohexylpiperidine Binding Protein 2
  • RP1-286D6.4 2
  • CEP104 5
  • Cep104 4


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X