Anti-Mouse IVNS1ABP (KIAA0850) Polyclonal Antibody, Rabbit

Product#: MK08500910
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse IVNS1ABP (KIAA0850) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MK08500910
Quantity 50 µg (250 µL)
Gene :mouse Influenza virus NS1A binding protein (mIVNS1ABP, mKIAA0850)
Immunogen GX0474 (GST-fusion protein, 172 amino acids)
    SDPYGQKGLKNCDVFDPVTKSWTSCAPLNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYN
    PENNTWTLIAPMNVARRGAGVAVLDGKLFVGGGFDGSHAISCVEMYDPTRNEWKMMGNMTS
    PRSNAGITTVGNTIYAVGGFDGNEFLNTVEVYNPQSNEWSPYTKIFQF
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Human/ Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
Specific to recombinant protein GX0474. This antibody detects mIVNS1ABP protein. It also recognizes human IVNS1ABP protein. Details are shown in the InGaP database.
    Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

Description

Mouse KIAA0850 (mKIAA0850) protein is a homologue of human KIAA0850 (ref. 1). KIAA0850 is identical to IVNS1ABP. Rabbit anti-mouse IVNS1ABP (mIVNS1ABP, mKIAA0850) antibody is raised against GST-fused recombinant protein (GX0474) containing following sequence.

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for IVNS1ABP Gene

  • Influenza Virus NS1A Binding Protein 2 3 5
  • Aryl Hydrocarbon Receptor-Associated Protein 3 2 3 4
  • KLHL39 2 3 4
  • NS1-BP 2 3 4
  • ARA3 2 3 4
  • Influenza Virus NS1A-Binding Protein 3 4
  • Kelch-Like Family Member 39 2 3
  • Kelch-Like Protein 39 3 4
  • NS1-Binding Protein 3 4
  • KIAA0850 2 4
  • HSPC068 2 3
  • FLARA3 3 4
  • NS1BP 3 4
  • NS-1 2 3
  • ND1 2 3
  • Aryl Hydrocarbon Receptor-Associated 3 3
  • NCX Downstream Gene 1 3
  • IVNS1ABP 5
  • NS1 4


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X