Anti-Mouse KIF17 (KIAA1405) Polyclonal Antibody, Rabbit
General information
| Cat. No. |
:FNK-MK14050310 |
| Quantity |
:100 µg (200 µL) |
| Gene |
:mouse kinesin family member 17 (mKIF17, mKIAA1405) |
| Immunogen |
:GX0352 (GST-fusion protein, 233 amino acids)
LGGHFGDKVGREELLSACPFSVVQLRAAEVEIKDLQSEFQLEKIDYLATIRRQERDSMLFQQLLE
QVQPLIRRDCNYSNLEKIRRESSWDEDNGFWKIPDPIILKTSLPVAVPTGTQNKPARKTSAVDSG
EPHMQEEDRYKLMLSRSDSENIASNYFRSKRASQILSTDPMKSLTYHNSPPGLNSSLSNNSALP
PTQTPEMPQPRPFRLESLDIPFSKAKRKKSKNSFGGEPL |
| Format |
:Rabbit IgG purified with Protein A affinity chromatography. |
| Constitution |
:PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species |
:Mouse |
| Host Species |
:Rabbit |
| Label |
:Unlabeled |
| Cross Reactivity |
:Human/ Mouse |
| Application |
:Western blotting (1 : 1,000), Immunoprecipitation. Other applications have not been tested. |
| Specificity |
:Specific to recombinant protein GX0352. This antibody detects endogenous mKIF17 protein in several
tissues and cells. It also recognizes human KIF17 protein. Details are shown in the InGaP database.
Other species have not been tested.
|
| Storage |
:Store at -20°C. Avoid freeze-thaw cycles. |
Anti-Mouse KIF17 (KIAA1405)

Western blot analysis
- Adult Mouse Tissues -
- 1:Heart, 2:Lung, 3:Liver, 4:Muscle, 5:Kidney, 6:Testis, 7:Pancreas, 8:Thymus, 9:Spleen, 10:Brain, 11:Prostate.
- Cell Lines -
- 12:B16 cells, 13:F9 cells, 14:Neuro2A cells.
References
- Hara, Y. et al.: DNA Res., 10, 129 (2003).
- Koga, H. et al.: DNA Res., 11, 293 (2004).
- Chennathukuzhi, V. et al.: PNAS 100, 15566 (2003).
Aliases for KIF17 Gene
- Kinesin Family Member 17 2 3 5
- Kinesin-Like Protein KIF17 2 3 4
- KIF3-Related Motor Protein 2 3 4
- KIF3X 2 3 4
- KIF17 Variant Protein 2 3
- KIAA1405 2 4
- KIF17B 2 3
- KLP-2 2 3
- OSM-3 2 3
- KIF17 5