Anti-Mouse KIF17 (KIAA1405) Polyclonal Antibody, Rabbit

Product#: MK14050310
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse KIF17 (KIAA1405) Polyclonal Antibody, Rabbit


General information 

Cat. No. MK14050310
Quantity 100 µg (200 µL)
Gene mouse kinesin family member 17 (mKIF17, mKIAA1405)
Immunogen GX0352 (GST-fusion protein, 233 amino acids)
    LGGHFGDKVGREELLSACPFSVVQLRAAEVEIKDLQSEFQLEKIDYLATIRRQERDSMLFQQLLE
    QVQPLIRRDCNYSNLEKIRRESSWDEDNGFWKIPDPIILKTSLPVAVPTGTQNKPARKTSAVDSG
    EPHMQEEDRYKLMLSRSDSENIASNYFRSKRASQILSTDPMKSLTYHNSPPGLNSSLSNNSALP
    PTQTPEMPQPRPFRLESLDIPFSKAKRKKSKNSFGGEPL
Format Rabbit IgG purified with Protein A affinity chromatography.
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity Human/ Mouse 
Application   Western blotting (1 : 1,000), Immunoprecipitation. Other applications have not been tested.
Specificity
Specific to recombinant protein GX0352. This antibody detects endogenous mKIF17 protein in several
    tissues and cells. It also recognizes human KIF17 protein. Details are shown in the InGaP database. 

    Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

Anti-Mouse KIF17 (KIAA1405)
MK14050310_fig2.png

Western blot analysis

  • Adult Mouse Tissues -
    • 1:Heart, 2:Lung, 3:Liver, 4:Muscle, 5:Kidney, 6:Testis, 7:Pancreas, 8:Thymus, 9:Spleen, 10:Brain, 11:Prostate.
  • Cell Lines -
    • 12:B16 cells, 13:F9 cells, 14:Neuro2A cells.


References

  1. Hara, Y. et al.: DNA Res., 10, 129 (2003).
  2. Koga, H. et al.: DNA Res., 11, 293 (2004).
  3. Chennathukuzhi, V. et al.: PNAS 100, 15566 (2003).
 

Aliases for KIF17 Gene

  • Kinesin Family Member 17 2 3 5
  • Kinesin-Like Protein KIF17 2 3 4
  • KIF3-Related Motor Protein 2 3 4
  • KIF3X 2 3 4
  • KIF17 Variant Protein 2 3
  • KIAA1405 2 4
  • KIF17B 2 3
  • KLP-2 2 3
  • OSM-3 2 3
  • KIF17 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X