Anti-Mouse JMJD2B (KIAA0876) Polyclonal Antibody, Rabbit

Product#: MKA0876AF
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse JMJD2B (KIAA0876) Polyclonal Antibody, Rabbit


General information 

Cat. No. MKA0876AF
Quantity 50 µg (250 µL)
Gene mouse jumonji domain containing 2B (JMJD2B) (mJMJD2B, mKIAA0876)
Immunogen GX2472 (GST-fusion protein, 156 amino acids)
    HTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAIGFFPGSSQGCDAFLRHKMTL
    ISPIILKKYGIPFSRITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATLRWIDYGKVA
    TQCTCRKDMVKISMDVFVRILQPERYEQWKQGRDLTVLDH
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
Specific to recombinant protein GX2472. This antibody detects mJMJD2B protein.
    Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for KDM4B Gene

  • Lysine Demethylase 4B 2 3 5
  • JmjC Domain-Containing Histone Demethylation Protein 3B 3 4
  • [Histone H3]-Trimethyl-L-Lysine(9) Demethylase 4B 3 4
  • Jumonji Domain-Containing Protein 2B 3 4
  • Lysine (K)-Specific Demethylase 4B 2 3
  • Lysine-Specific Demethylase 4B 3 4
  • Jumonji Domain Containing 2B 2 3
  • Tudor Domain Containing 14B 2 3
  • KIAA0876 2 4
  • TDRD14B 2 3
  • JMJD2B 3 4
  • EC 1.14.11.66 4
  • EC 1.14.11 51
  • JHDM3B 4
  • KDM4B 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X