Anti-Mouse KIDINS220 (KIAA1250) Polyclonal Antibody, Rabbit
General information
| Cat. No. |
:FNK-MK12500310 |
| Quantity |
:100 µg (200 µL) |
| Gene |
:mouse kinase D-interacting substance of 220 kDa (mKIDINS220, mKIAA1250) |
| Immunogen |
:GX0506 (GST-fusion protein, 187 amino acids)
SDSGVRSNESSPNHSLHNEAADDSQLEKANLIELEDEGHSGKRGMPHSLSGLQDPVIARMSIC
SEDKKSPSECSLIASSPEESWPSCQKAYNLNRTPSTVTLNNNTAPTNRANQNFDEIEGVRETSQ
VILRPGPSPNPTAVQNENLKSMAHKRSQRSSYTRLSKDASELHAASSDSTGFGEERESIL |
| Format |
:Rabbit IgG purified with Protein A affinity chromatography. |
| Constitution |
:PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species |
:Mouse |
| Host Species |
:Rabbit |
| Label |
:Unlabeled |
| Cross Reactivity |
:Mouse |
| Application |
:Western blotting (1 : 1,000), Immunoprecipitation. Other applications have not been tested. |
| Specificity |
:Specific to recombinant protein GX0506. This antibody detects endogenous mKIDINS220 protein in
several tissues and cells. Details are shown in the InGaP database. Other species have not been tested.
|
| Storage |
:Store at -20°C. Avoid freeze-thaw cycles. |
Anti-Mouse KIDINS220 (KIAA1250)

Western blot analysis
- Adult Mouse Tissues -
- 1:Heart, 2:Lung, 3:Liver, 4:Muscle, 5:Kidney, 6:Testis, 7:Pancreas, 8:Thymus, 9:Spleen, 10:Brain, 11:Prostate.
- Cell Lines -
- 12:B16 cells, 13:F9 cells, 14:Neuro2A cells.
References
- Hara, Y. et al.: DNA Res., 10, 129 (2003).
- Koga, H. et al.: DNA Res., 11, 293 (2004).
- Iglesias, T. et al.: J Biol Chem., 275, 40048 (2000).
Aliases for KIDINS220 Gene
- Kinase D Interacting Substrate 220 2 3 5
- Ankyrin Repeat-Rich Membrane-Spanning Protein 2 3 4
- ARMS 2 3 4
- Kinase D-Interacting Substrate Of 220 KDa 3 4
- Kinase D-Interacting Substrate 220kDa 2 3
- KIDINS220 5
- KIAA1250 4
- SINO 3