Anti-Mouse KIDINS220 (KIAA1250) Polyclonal Antibody, Rabbit

Product#: FNK-MK12500310
$495.39
Availability:
Ships in 1-2 Weeks

Anti-Mouse KIDINS220 (KIAA1250) Polyclonal Antibody, Rabbit


General information 

Cat. No. :FNK-MK12500310
Quantity 100 µg (200 µL)
Gene mouse kinase D-interacting substance of 220 kDa (mKIDINS220, mKIAA1250)
Immunogen GX0506 (GST-fusion protein, 187 amino acids)
    SDSGVRSNESSPNHSLHNEAADDSQLEKANLIELEDEGHSGKRGMPHSLSGLQDPVIARMSIC
    SEDKKSPSECSLIASSPEESWPSCQKAYNLNRTPSTVTLNNNTAPTNRANQNFDEIEGVRETSQ
    VILRPGPSPNPTAVQNENLKSMAHKRSQRSSYTRLSKDASELHAASSDSTGFGEERESIL
Format Rabbit IgG purified with Protein A affinity chromatography.
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   Western blotting (1 : 1,000), Immunoprecipitation. Other applications have not been tested.
Specificity
Specific to recombinant protein GX0506. This antibody detects endogenous mKIDINS220 protein in
    several tissues and cells. Details are shown in the InGaP database. 
Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

Anti-Mouse KIDINS220 (KIAA1250)
MK12500310_fig2.png

Western blot analysis

  • Adult Mouse Tissues -
    •  1:Heart, 2:Lung, 3:Liver, 4:Muscle, 5:Kidney, 6:Testis, 7:Pancreas, 8:Thymus, 9:Spleen, 10:Brain, 11:Prostate.
  • Cell Lines - 
    • 12:B16 cells, 13:F9 cells, 14:Neuro2A cells.


References

  1. Hara, Y. et al.: DNA Res., 10, 129 (2003).
  2. Koga, H. et al.: DNA Res., 11, 293 (2004).
  3. Iglesias, T. et al.: J Biol Chem., 275, 40048 (2000). 
 

Aliases for KIDINS220 Gene

  • Kinase D Interacting Substrate 220 2 3 5
  • Ankyrin Repeat-Rich Membrane-Spanning Protein 2 3 4
  • ARMS 2 3 4
  • Kinase D-Interacting Substrate Of 220 KDa 3 4
  • Kinase D-Interacting Substrate 220kDa 2 3
  • KIDINS220 5
  • KIAA1250 4
  • SINO 3


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X