Anti-Mouse KIAA0226 Polyclonal Antibody, Rabbit

Product#: MK02260910
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse KIAA0226 Polyclonal Antibody, Rabbit


General information 

Cat. No. MK02260910
Quantity 50 µg (250 µL)
Gene mouse KIAA0226, hypothetical protein LOC224118 (mKIAA0226)
Immunogen GX0425 (GST-fusion protein, 184 amino acids)
    LFNVQDINSALYRKVKLLNQVRLLRVQLYHMKNMFKTCRLAKELLDSFDVVPGHLTEDLHLYSL
    SDLTATKKGELGPRLAELTRAGAAHVERCMLCQAKGFICEFCQNEEDVIFPFELHKCRTCEECK
    ACYHKTCFKSGRCPRCERLQARRELLAKQSLESYLSDYEEEPTEALALEATVLETT
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity Human/ Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
Specific to recombinant protein GX0425. This antibody detects mKIAA0226 protein. It also recognizes
    human KIAA0226 protein. Details are shown in the InGaP database.
 Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for RUBCN Gene

  • Rubicon Autophagy Regulator 2 3 5
  • KIAA0226 2 3 4
  • Run Domain Beclin-1-Interacting And Cysteine-Rich Domain-Containing Protein 3 4
  • RUN And Cysteine Rich Domain Containing Beclin 1 Interacting Protein 2 3
  • Beclin-1 Associated RUN Domain Containing Protein 3 4
  • Rundataxin 2 3
  • Rubicon 2 4
  • Baron 3 4
  • RUN Domain And Cysteine-Rich Domain Containing, Beclin 1-Interacting Protein 3
  • RUBICON 3
  • SCAR15 3
  • RUBCN 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X