Anti-Mouse KBTBD2 (KIAA1489) Polyclonal Antibody, Rabbit

Product#: MK14890910
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse KBTBD2 (KIAA1489) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MK14890910
Quantity 50 µg (250 µL)
Gene :mouse Kelch repeat and BTB (POZ) domain containing 2 (KBTBD2) (mKBTBD2, mKIAA1489)
Immunogen GX0633 (GST-fusion protein, 233 amino acids)
    GGELNRRTVERYDTEKDEWTMVSPLPCAWQWSAAVVVHDCIYVMTLNLMYCYFPRSDSWVE
    MAMRQTSRSFASAAAFGDKIFYIGGLHIATNSGIRLPSGTVDGSSVTVEIYDVNKNEWKMAANIP
    AKRYSDPCVRAVVISNSLCVFMRETHLNERAKYVTYQYDLELDRWSLRQHISERVLWDLGRDF
    RCTVGKLYPSCLEESPWKPPTYLFSPDGTEEFELDGEMVALPPV
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
Specific to recombinant protein GX0633. This antibody detects mKBTBD2 protein. Details are shown
    in the InGaP database. Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for KBTBD2 Gene

  • Kelch Repeat And BTB Domain Containing 2 2 3 5
  • Kelch Repeat And BTB Domain-Containing Protein 2 3 4
  • Kelch Repeat And BTB (POZ) Domain Containing 2 2 3
  • BTB And Kelch Domain-Containing Protein 1 3 4
  • BTB And Kelch Domain Containing 1 2 3
  • BKLHD1 3 4
  • DKFZP566C134 2
  • KIAA1489 4
  • KBTBD2 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X