Anti-Mouse RRBP1 (KIAA1398) Polyclonal Antibody, Rabbit

Product#: MK13980310
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse RRBP1 (KIAA1398) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MK13980310
Quantity 100 µg (200 µL)
Gene :mouse ribosome-binding protein (mRRBP1, mKIAA1398)
Immunogen GX0745 (GST-fusion protein, 132 amino acids)
    AVPPAEQDPMKLKTQLERTEATLEDEQTRRQKLTAEFEEAQRTACRIQEELEELRAASPLGSSA
    KEEVTQLKERLEKEKRLTSDLGRAAIKLQELLKTTQEQLTKEKDTVKKLQEQLGKAEDGSSSKE
    GTSV
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
Specific to recombinant protein GX0745. This antibody detects endogenous mRRBP1 protein in several
    tissues and cells.    Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.


Anti-RRBP1.png


References

  1. Hara, Y. et al.: DNA Res., 10, 129 (2003).
  2. Koga, H. et al.: DNA Res., 11, 293 (2004).
  3. Langley, R. et al.: DNA Cell Biol., 17, 449 (1998).
  4. Diefenbach, R.J. et al.: BBRC 319, 987 (2004). 
 

Aliases for RRBP1 Gene

  • Ribosome Binding Protein 1 2 3 5
  • Ribosome Binding Protein 1 Homolog 180kDa (Dog) 2 3
  • 180 KDa Ribosome Receptor Homolog 3 4
  • Ribosome-Binding Protein 1 3 4
  • Ribosome Receptor Protein 3 4
  • ES/130-Related Protein 3 4
  • ES/130 2 3
  • RRp 3 4
  • HES 2 3
  • Ribosome Binding Protein 1 (Dog 180kD Homolog) 2
  • KIAA1398 4
  • ES130 3
  • RRBP1 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X