Anti-Mouse EIF4A3 (KIAA0111) Polyclonal Antibody, Rabbit
Product#: FNK-MKA0111AF
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Mouse EIF4A3 (KIAA0111) Polyclonal Antibody, Rabbit
General information
| Cat. No. | ：FNK-MKA0111AF |
| Quantity | ：50 µg (250 µL) |
| Gene | ：mouse eukaryotic translation initiation factor 4A (mEIF4A3, mKIAA0111) |
| Immunogen | ：GX0612 (GST-fusion protein, 171 amino acids) VKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVS SMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSG RYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Human/ Mouse |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX0612. This antibody detects mEIF4A3 protein. It also recognizes
human EIF4A3 protein. Details are shown in the InGaP database. Other species have not been tested. |
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Aliases for EIF4A3 Gene
- Eukaryotic Translation Initiation Factor 4A3 2 3 5
- Eukaryotic Initiation Factor 4A-Like NUK-34 3 4
- DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 48 2 3
- Eukaryotic Initiation Factor 4A-III 3 4
- ATP-Dependent RNA Helicase EIF4A-3 3 4
- ATP-Dependent RNA Helicase DDX48 3 4
- Nuclear Matrix Protein 265 3 4
- DEAD Box Protein 48 3 4
- EIF-4A-III 3 4
- EIF4A-III 3 4
- EIF4AIII 2 3
- KIAA0111 2 4
- NMP 265 3 4
- DDX48 3 4
- Fal1 2 3
- Eukaryotic Translation Initiation Factor 4A, Isoform 3 2
- Eukaryotic Translation Initiation Factor 4A Isoform 3 4
- Eukaryotic Translation Initiation Factor 4A 3
- EC 3.6.4.13 4
- HNMP 265 4
- EC 3.6.1 51
- NMP265 3
- EIF4A3 5
- MUK34 3
- NUK34 3
- RCPS 3
