0
Precision Quality to Your Research verified ISO 13485 Certified | SBA WOSB | NJ MWBE · NYC MWBE · Illinois BEP arrow_forward View Details

Anti-Mouse E2F3 (KIAA0075) Polyclonal Antibody, Rabbit

Product#: FNK-MKA0075AF
$495.39
Availability:
Ships in 1-2 Weeks

Anti-Mouse E2F3 (KIAA0075) Polyclonal Antibody, Rabbit


General information 

Cat. No. ：FNK-MKA0075AF
Quantity ：50 µg (250 µL)
Gene ：mouse Transcription factor E2F3 (mE2F3, mKIAA0075)
Immunogen ：GX1865 (GST-fusion protein, 165 amino acids)
    ENQRLAYVTYQDIRKISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETH
    RPMKTNNQDHNGNIPKPTSKDLASNNSGHSDCSVSTANLSPLASPANLLQQTEDQIPSNLEGP 
    FVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKL
Format ：Affinity Purified Rabbit IgG
Constitution ：PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species ：Mouse
Host Species ：Rabbit 
Label ：Unlabeled
Cross Reactivity ：Mouse
Application   ：Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
：Specific to recombinant protein GX1865. This antibody detects mE2F3 protein.
    Other species have not been tested.
Storage ：Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for E2F3 Gene

  • E2F Transcription Factor 3 2 3 5
  • Transcription Factor E2F3 3 4
  • E2F-3 3 4
  • KIAA0075 4
  • E2F3 5


Logo_proteinexpress.png

Related Products

Recently Viewed

ICG Alkyne

$2068.48

Low Copy Number Plasmid Maxiprep Kit (25 Preps)

$420.00

Low Copy Number Plasmid Maxiprep Kit (10 Preps)

$180.00

HRP-labelled MAD Reagent

$1618.27

Express Endofree Plasmid Midiprep Kit (10 Preps)

$120.00

Plasmid Midi Kit I (25 Preps)

$125.00

TAMRA Dichlorotriazine

$9276.80

FluxMPS™ Dulbecco’s Modified Eagle Medium/ Ham's F-12 Nutrient Mixture (DMEM/F-12) (1:1) with Trace Elements w/o Sodium Bicarbonate: 1X Liquid

$49.50

Culture Tube, 14mL, 17 x 100mm, PP, w/ attached 2-position screw-cap, printed graduations, sterile, individually wrapped, 500/case

$332.77

10.4 ml 24-well Deep Well Plate, V-Bottom, Square well, Equivalent to Thermo Fisher #95040480, sterile, 5/pk, 50/cs

$204.18

500mL PETG Square Storage Bottle with Bi-Directional Transfer Cap with TPE Tube (60cm 1/4" ID 7/16" OD), Heat seal ,Vent Filter (0.22 μm 4.5cm²), Sterile, 1/pk, 10/cs

$1077.29

10.4 ml 24-well Deep Well Plate, V-Bottom, Square well, Equivalent to Thermo Fisher #95040470, non-sterile, 5/pk, 50/cs

$186.42

250mL PETG Square Storage Bottle with Bi-directional Transfer Cap with TPE Tube (60cm 1/4" ID 3/8" OD), Male CPC Connector with Female Sealing Cap, Vent Filter (0.22 μm Φ24mm), Sterile, 1/pk, 10/cs

$1536.09
Satisfaction
Quality Rating
Value Rating
Style Rating

X