Anti-Mouse DNAH17 (KIAA3028) Polyclonal Antibody, Rabbit
Anti-Mouse DNAH17 (KIAA3028) Polyclonal Antibody, Rabbit
DiagnoCine offers multiple types of excellent Dynein I Anti- Dynein Antibodies to researchers studying Cellular Functions, Organelle Transportation, Cellular Respiration, Mitotic Spindle Positioning, Cell Division, Microtubule, and Intracellular Replication.
Human diseases include Defective brain development, Congenital anomalies, Impaired cognitive function, Muscular dystrophy, Motor neuron degeneration, Lissencephaly, Amyotrophic lateral sclerosis, Huntington's disease, and Alzheimer's disease.
Anti- Dynein Antibodies have excellent quality and this highly pure antibody can be adapted for Western Blots research with optimization.
General information
| Cat. No. | ：FNK-MKA3028AF |
| Quantity | ：50 µg (250 µL) |
| Gene | ：mouse Dynein heavy chain 17, axonemal (DNAH17) (mDNAH17, mKIAA3028) |
| Immunogen | ：GX2083 (GST-fusion protein, 122 amino acids) RKNEWPLDKMCLSVEVTKKNREDMTAPPREGSYVYGLFMEGARWDTQTGVIAEAR LKDLTPVMPVIFIKAIPVDRMETKNIYECPVYKTRIRGPTYVWTFNLKTKEKAAKWILA AVALLLQV |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Mouse |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX2083. This antibody detects mDNAH17 protein.
Other species have not been tested. |
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Aliases for DNAH17 Gene
- Dynein Axonemal Heavy Chain 17 2 3 5
- DNEL2 2 3 4
- Axonemal Dynein Heavy Chain-Like Protein 1 3 4
- Ciliary Dynein Heavy Chain-Like Protein 1 3 4
- Dynein, Axonemal, Heavy Polypeptide 17 2 3
- Axonemal Beta Dynein Heavy Chain 17 3 4
- Dynein Heavy Chain 17, Axonemal 3 4
- Dynein Light Chain 2, Axonemal 3 4
- Ciliary Dynein Heavy Chain 17 3 4
- DNAHL1 3 4
- Dynein, Axonemal, Heavy Chain Like 1 2
- Dynein, Axonemal, Heavy Like 1 2
- FLJ40457 2
- SPGF39 3
- DNAH17 5
