Anti-Mouse DZIP3 (KIAA0675) Polyclonal Antibody, Rabbit
Product#: FNK-MK06750910
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Mouse DZIP3 (KIAA0675) Polyclonal Antibody, Rabbit
General information
| Cat. No. | ：FNK-MK06750910 |
| Quantity | ：50 µg (250 µL) |
| Gene | ：mouse DAZ interacting protein 3 zinc finger (mDZIP3, mKIAA0675) |
| Immunogen | ：GX0307 (GST-fusion protein, 125 amino acids) SEPLMINWERITDRLKTAFPQQTRKELTDFLQQLKDSHGKSVSRLTFDEIVYKISQMIEPKKSES EEKSAQDGNNASPSHTASQPNAPQDPKSAQGSATWEGDKDMVRPNLLTVNTFRSERKRMV |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Mouse |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX0307. This antibody detects mDZIP3 protein. It also recognizes
human DZIP3 protein.Details are shown in the InGaP database. Other species have not been tested. |
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Aliases for DZIP3 Gene
- DAZ Interacting Zinc Finger Protein 3 2 3 5
- HRUL138 2 3 4
- Human RNA-Binding Ubiquitin Ligase Of 138 KDa 2 3
- Protein Phosphatase 1, Regulatory Subunit 66 2 3
- RING-Type E3 Ubiquitin Transferase DZIP3 3 4
- RNA-Binding Ubiquitin Ligase Of 138 KDa 3 4
- DAZ Interacting Protein 3, Zinc Finger 2 3
- E3 Ubiquitin-Protein Ligase DZIP3 3 4
- DAZ-Interacting Protein 3 3 4
- PPP1R66 2 3
- RNA-Binding RING-H2 Protein-Ubiquitin Ligase 3
- Zinc Finger DAZ Interacting Protein 3 3
- UURF2 Ubiquitin Ligase 3
- EC 2.3.2.27 4
- KIAA0675 4
- UURF2 3
- DZIP3 5
