Anti-Mouse DNAH6 (KIAA1697) Polyclonal Antibody, Rabbit

Product#: FNK-MKA1697AF
$495.39
Availability:
Ships in 1-2 Weeks

Anti-Mouse DNAH6 (KIAA1697) Polyclonal Antibody, Rabbit


DiagnoCine offers multiple types of excellent Dynein I Anti- Dynein Antibodies  to researchers studying Cellular Functions, Organelle Transportation, Cellular Respiration, Mitotic Spindle Positioning, Cell Division, Microtubule, and Intracellular Replication. 

Human diseases include Defective brain development, Congenital anomalies, Impaired cognitive function, Muscular dystrophy, Motor neuron degeneration, Lissencephaly, Amyotrophic lateral sclerosis, Huntington's disease, and Alzheimer's disease.

Anti- Dynein Antibodies  have excellent quality and this highly pure antibody can be adapted for Western Blots research with optimization. 



General information 

Cat. No. :FNK-MKA1697AF
Quantity :50 µg (250 µL)
Gene :mouse dynein, axonemal, heavy chain 6 (DNAH6) (mDNAH6, mKIAA1697)
Immunogen :GX2241 (GST-fusion protein, 143 amino acids) 
    LSFKYNMIPVYRDQAAVIESAKDIQFGTELPMDKELPSPEDGVLVHGMFMDASRWD
     DKDMVIEDALPGQMNPMLPVVHFEPKQNYEPVHTLYHSPLYKTGARAGTLSTTGHS 
    TNFVVTVLLPSKRISDYWISKGSALLCQLSE
Format :Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species :Rabbit 
Label :Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
:Specific to recombinant protein GX2241. This antibody detects mDNAH6 protein.
    Other species have not been tested.
Storage :Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for DNAH6 Gene

  • Dynein Axonemal Heavy Chain 6 2 3 5
  • Dynein, Axonemal, Heavy Polypeptide 6 2 3
  • Axonemal Beta Dynein Heavy Chain 6 3 4
  • Dynein Heavy Chain 6, Axonemal 3 4
  • Ciliary Dynein Heavy Chain 6 3 4
  • Dynein Heavy Chain-Like 1 2 3
  • Dnahc6 2 3
  • DNHL1 3 4
  • HL-2 2 3
  • HL2 3 4
  • FLJ37357 2
  • KIAA1697 4
  • DNAHC6 4
  • DNAH6 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X