Anti-Mouse PHLPP (KIAA0606) Polyclonal Antibody, Rabbit

Product#: FNK-MKA0606AF
$495.39
Availability:
Ships in 1-2 Weeks

Anti-Mouse PHLPP (KIAA0606) Polyclonal Antibody, Rabbit


General information 

Cat. No. :FNK-MKA0606AF
Quantity :50 µg (250 µL)
Gene :mouse PH domain and leucine rich repeat protein phosphatase (mPHLPP, mKIAA0606)
Immunogen :GX0356 (GST-fusion protein, 118 amino acids)
    GSRVEVEVDIHCSRAKEKERQQHLLQVPAEASDEGIVISANEDESGLSKKADFSAVGTIGRRRA
    NGSVAPQERSHNVIEVAADAPLRKPGGYFAAPAQPDPDDQFIIPPELEEEVKEI
Format :Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species :Rabbit 
Label :Unlabeled
Cross Reactivity :Human/ Mouse 
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
:Specific to recombinant protein GX0356. This antibody detects mPHLPP protein. It also recognizes
    human PHLPP protein.    Other species have not been tested.
Storage :Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for PHLPP1 Gene

  • PH Domain And Leucine Rich Repeat Protein Phosphatase 1 2 3 5
  • SCOP 2 3 4
  • Pleckstrin Homology Domain Containing, Family E (With Leucine Rich Repeats) Member 1 2 3
  • PH Domain Leucine-Rich Repeat-Containing Protein Phosphatase 1 3 4
  • Suprachiasmatic Nucleus Circadian Oscillatory Protein 3 4
  • Protein Phosphatase, Mg2+/Mn2+ Dependent 3A 2 3
  • PH Domain-Containing Family E Member 1 3 4
  • EC 3.1.3.16 4 51
  • KIAA0606 2 4
  • PLEKHE1 3 4
  • PHLPP 3 4
  • PPM3A 2 3
  • Pleckstrin Homology Domain-Containing Family E Member 1 4
  • PH Domain And Leucine Rich Repeat Protein Phosphatase 2
  • SCN Circadian Oscillatory Protein 3
  • PHLPP1 5
  • HSCOP 4


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X