Anti-Mouse EHMT1 (KIAA1876) Polyclonal Antibody, Rabbit

Product#: FNK-MKA1876AF
$495.39
Availability:
Ships in 1-2 Weeks

Anti-Mouse EHMT1 (KIAA1876) Polyclonal Antibody, Rabbit


General information 

Cat. No. :FNK-MKA1876AF
Quantity :50 µg (250 µL)
Gene :mouse Euchromatic histone-lysine N-methyltransferase 1 (Histone H3-K9 methyltransferase 5,
    G9a-like protein 1, EHMT1) (mEHMT1, mKIAA1876)
Immunogen :GX0523 (GST-fusion protein, 156 amino acids) 
    CEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEPNLVP
    VRVFMSHQDLRFPRIAFFSTRLIQAGEQLGFDYGERFWDVKGKLFSCRCGSSKCRH 
    SSAALAQRQASAAQEPQENGLPDTSSAAAADPPLILMKCGFAF
Format :Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species :Rabbit 
Label :Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
:Specific to recombinant protein GX0523. This antibody detects mEHMT1 protein.
    Other species have not been tested.
Storage :Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for EHMT1 Gene

  • Euchromatic Histone Lysine Methyltransferase 1 2 3 5
  • Eu-HMTase1 2 3 4
  • KMT1D 2 3 4
  • Euchromatic Histone-Lysine N-Methyltransferase 1 3 4
  • Histone-Lysine N-Methyltransferase EHMT1 3 4
  • Histone H3-K9 Methyltransferase 5 3 4
  • Lysine N-Methyltransferase 1D 3 4
  • EHMT1 Intronic Transcript 1 2 3
  • G9a-Like Protein 1 3 4
  • H3-K9-HMTase 5 3 4
  • EUHMTASE1 3 4
  • KIAA1876 2 4
  • GLP1 3 4
  • GLP 3 4
  • Histone-Lysine N-Methyltransferase, H3 Lysine-9 Specific 5 3
  • Euchromatic Histone Methyltransferase 1 2
  • BA188C12.1 2
  • EC 2.1.1.- 4
  • EHMT1-IT1 3
  • FLJ12879 2
  • FLJ40292 2
  • FP13812 3
  • KLEFS1 3
  • EHMT1 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X