Anti-Mouse DDEF2 (KIAA0400) Polyclonal Antibody, Rabbit
General information
| Cat. No. | :FNK-MKA0400AF |
| Quantity | :50 µg (250 µL) |
| Gene | :mouse development and differentiation enhancing factor 2 (mDDEF2, mKIAA0400) |
| Immunogen | :GX1332 (GST-fusion protein, 251 amino acids) YSRMQSLTLDVLGTSELLLAKNIGNAGFNEIMECCLPSEDPVKPNPGSDMIARKDYITAKYMER RYARKKHADTAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVD RTSLHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIANESGETPLDIAKR LKHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDESDDDVDEKLQPSPNRREDRP |
| Format | :Affinity Purified Rabbit IgG |
| Constitution | :PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | :Mouse |
| Host Species | :Rabbit |
| Label | :Unlabeled |
| Cross Reactivity | :Human/ Mouse |
| Application | :Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
:Specific to recombinant protein GX1332. This antibody detects mDDEF2 protein. It also recognizes
human DDEF2 protein. Other species have not been tested. |
| Storage | :Store at -20°C. Avoid freeze-thaw cycles. |
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Aliases for ASAP2 Gene
- ArfGAP With SH3 Domain, Ankyrin Repeat And PH Domain 2 2 3 5
- PAP 2 3 4
- Arf-GAP With SH3 Domain, ANK Repeat And PH Domain-Containing Protein 2 3 4
- Paxillin-Associated Protein With ARF GAP Activity 3 3 4
- Development And Differentiation-Enhancing Factor 2 3 4
- Pyk2 C-Terminus-Associated Protein 3 4
- Centaurin, Beta 3 2 3
- KIAA0400 2 4
- CENTB3 2 3
- DDEF2 3 4
- SHAG1 2 3
- PAG3 3 4
- Development And Differentiation Enhancing Factor 2 2
- PYK2 C Terminus-Associated Protein 3
- Pap-Alpha 3
- AMAP2 3
- ASAP2 5

Related Products
Recently Viewed
KOD One™ PCR Master Mix, 10 pack
$1501.92
Radicicol, 5mg
$475.59
iMatrix-332, 6x175 µg
$1803.20
Myricitrin (100 mg)
$1387.09












