Anti-Mouse PUM2 (KIAA0235) Polyclonal Antibody, Rabbit

Product#: MKA0235AF
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse PUM2 (KIAA0235) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MKA0235AF
Quantity 50 µg (250 µL)
Gene :mouse pumilio homolog 2 (mPUM2, mKIAA0235)
Immunogen GX0249 (GST-fusion protein, 150 amino acids)
    VQDQYGNYVIQHVLEHGRPEDKSKIVSEIRGKVLALSQHKFASNVVEKCVTHASRAERALLIDEV
    CCQNDGPHSALYTMMKDQYANYVVQKMIDMAEPAQRKIIMHKIRPHITTLRKYTYGKHILAKLEK
    YYLKNSPDLGPIGGPPNGML
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Human/ Mouse 
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
Specific to recombinant protein GX0249. This antibody detects mPUM2 protein. It also recognizes
    human PUM2 protein. Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for PUM2 Gene

  • Pumilio RNA Binding Family Member 2 2 3 5
  • PUMH2 2 3 4
  • Pumilio Homolog 2 3 4
  • Pumilio-2 3 4
  • KIAA0235 2 4
  • Pumilio Homolog 2 (Drosophila) 2
  • PUML2 3
  • PUM2 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X