Anti-Mouse REXO1 (KIAA1138) Polyclonal Antibody, Rabbit

Product#: MKA1138AF
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse REXO1 (KIAA1138) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MKA1138AF
Quantity 50 µg (250 µL)
Gene :mouse RNA exonuclease 1 (REX1) homolog (REXO1) (mREXO1, mKIAA1138)
Immunogen GX1676 (GST-fusion protein, 241 amino acids)
    LVSSSGRCVRSEECYYHWGRLRRNRVAGGWETQYMCCSAAVGSVGCQVAKQHV
    QDGRKENLEGFVRTFQKELPEDAHAGVFALDCEMSYTTYGLELTRVTVVDTDMQV
    VYDTFVKPDNEVVDYNTRFSGVTEADLVDTSITLRDVQAVLLSMFSADTILIGHSLES
    DLLALKVIHGTVVDTSVLFPHRLGLPYKRSLRNLMADYLRQIIQDNVDGHSSSEDASA
    CMHLVIWKIREDAKTKR
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
:Specific to recombinant protein GX1676. This antibody detects mREXO1 protein.
    Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for REXO1 Gene

  • RNA Exonuclease 1 Homolog 2 3 4 5
  • EloA-BP1 2 3 4
  • Transcription Elongation Factor B Polypeptide 3-Binding Protein 1 3 4
  • Elongin-A-Binding Protein 1 3 4
  • TCEB3BP1 3 4
  • KIAA1138 2 4
  • ELOABP1 3 4
  • Transcription Elongation Factor B Polypeptide 3 Binding Protein 1 2
  • REX1, RNA Exonuclease 1 Homolog (S. Cerevisiae) 2
  • REX1, RNA Exonuclease 1 Homolog 3
  • Elongin A Binding Protein 1 2
  • EC 3.1.-.- 4
  • REXO1 5
  • REX1 3


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X