Anti-Mouse DYNC2H1 (KIAA1997) Polyclonal Antibody, Rabbit

Product#: FNK-MKA1997AF
$495.39
Availability:
Ships in 1-2 Weeks

Anti-Mouse DYNC2H1 (KIAA1997) Polyclonal Antibody, Rabbit


General information 

Cat. No. :FNK-MKA1997AF
Quantity :50 µg (250 µL)
Gene :mouse dynein, cytoplasmic 2, heavy chain 1 (DYNC2H1) (mDYNC2H1, mKIAA1997)
Immunogen :GX1500 (GST-fusion protein, 196 amino acids) 
    QKLASALLNQKCPLTWQSRWEGPEDPLQYLRGLVARTLAIQNWVEKAEKQVLLADTLDLSELF
    HPDTFLNALRQETARATGCSVDSLKFVASWKGRLQEAKLQIKISGLLLEGCSFDGNRLSENQHD 
    SPSVSSVLPCYMGWTPQGSYGPYSPDECISLPVYTSAERERVVTNIDVPCGGNQDQWIQCGA 
    ALFLKNQ
Format :Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species :Rabbit 
Label :Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
:Specific to recombinant protein GX1500. This antibody detects mDYNC2H1 protein.
    Other species have not been tested.
Storage :Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for DYNC2H1 Gene

  • Dynein Cytoplasmic 2 Heavy Chain 1 2 3 5
  • DYH1B 2 3 4
  • DHC2 2 3 4
  • Dynein, Cytoplasmic, Heavy Polypeptide 2 2 3
  • Cytoplasmic Dynein 2 Heavy Chain 1 3 4
  • Dynein Cytoplasmic Heavy Chain 2 3 4
  • Dynein Heavy Chain 11 3 4
  • Hdhc11 2 3
  • DHC1b 2 3
  • DNCH2 3 4
  • Cytoplasmic Dynein 2 Heavy Chain 4
  • Dynein Heavy Chain, Isotype 1B 3
  • Dynein Heavy Chain Isotype 1B 4
  • KIAA1997 4
  • DYNC2H1 5
  • SRPS2B 3
  • HDHC11 4
  • SRTD3 3
  • DHC1B 4
  • ATD3 3


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X