Anti-Mouse XPO5 (KIAA1291) Polyclonal Antibody, Rabbit
Product#: FNK-MK12910310
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Mouse XPO5 (KIAA1291) Polyclonal Antibody, Rabbit
General information
| Cat. No. | ：FNK-MK12910310 |
| Quantity | ：100 µg (200 µL) |
| Gene | ：mouse exportin 5 (mXPO5, mKIAA1291) |
| Immunogen | ：GX1085 (GST-fusion protein, 108 amino acids) AFQIYEALRPRYLEIRAVMEQIPEINKESLDQFDCKLLNPSLQKAADKRRKDHFKRLIAGCIGKPL GEQFRKEVHIKNLPWLFKKPKPMLETEVLDSEEGGLATIFEP |
| Format | ：Rabbit IgG purified with Protein A affinity chromatography. |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Mouse |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX1085. This antibody detects endogenous mXPO5 protein in several
tissues and cells. Details are shown in the InGaP database. Other species have not been tested. |
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
References
- Hara, Y. et al.: DNA Res., 10, 129 (2003).
- Koga, H. et al.: DNA Res., 11, 293 (2004).
- Bohnsack, M.T. et al.: EMBO J., 21, 6205 (2002).
- Lund, E. et al.: Science, 303, 95 (2004).
Aliases for XPO5 Gene
Recently Viewed
Daizein, 10mg (NGR)
$63.96
CATAROSEV™, Multi-Pack, 5 pcs
$672.00
PVSA-Citrate, 1X
$49.50
UltraClean PVSA-PBS, 1X
$67.54
UltraClean PVSA-TBS, 1X
$67.54
UltraClean PVSA-HEPES, 1X
$77.00
MES SDS Running Buffer [1X]
$66.00
UltraClean PVSA‑TE, 1X
$107.42
Expansin, Thermostable
$241.17
UltraClean PVSA-PIPES, 1X
$77.00
MOPS SDS Running Buffer [1X]
$60.50
UltraClean PVSA-MOPS, 1X
$55.00
Disulfide Bond PLUS Expression Kit
$1199.18
WEPRO8240H Core Kit
$3210.27
UltraClean PVSA‑SSC, 1X
$67.54
UltraClean PVSA-TBE, 1X
$44.00
WEPRO7240G Core Kit
$3210.27
WEPRO7240 Core Kit
$2965.67
WEPRO7240H Core Kit
$3210.27
Denaturing Gel-Loading Buffer
$402.22
Denaturing Gel-Loading Buffer
$229.84