Anti-Mouse UBR5 (KIAA0896) Polyclonal Antibody, Rabbit
General information
| Cat. No. | :FNK-MKA0896AF |
| Quantity | :50 µg (250 µL) |
| Gene | :mouse ubiquitin protein ligase E3 component n-recognin 5 (UBR5) (mUBR5, mKIAA0896) |
| Immunogen | :GX0167 (GST-fusion protein, 123 amino acids) LLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVEKMSMTERQDLVYF WTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPLYSSKQILKQKLLLAI KTKNFGFV |
| Format | :Affinity Purified Rabbit IgG |
| Constitution | :PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | :Mouse |
| Host Species | :Rabbit |
| Label | :Unlabeled |
| Cross Reactivity | :Mouse |
| Application | :Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
:Specific to recombinant protein GX0167. This antibody detects mUBR5 protein.
Other species have not been tested. |
| Storage | :Store at -20°C. Avoid freeze-thaw cycles. |
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Aliases for UBR5 Gene
- Ubiquitin Protein Ligase E3 Component N-Recognin 5 2 3 5
- EDD 2 3 4
- HYD 2 3 4
- E3 Ubiquitin-Protein Ligase, HECT Domain-Containing 1 3 4
- HECT-Type E3 Ubiquitin Transferase UBR5 3 4
- Hyperplastic Discs Protein Homolog 3 4
- E3 Ubiquitin-Protein Ligase UBR5 3 4
- Progestin-Induced Protein 3 4
- KIAA0896 2 4
- EDD1 3 4
- DD5 2 3
- E3 Ubiquitin Protein Ligase, HECT Domain Containing, 1 2
- E3 Identified By Differential Display 3
- EC 2.3.2.26 4
- EC 6.3.2 51
- UBR5 5
- HHYD 4

Related Products
Recently Viewed
CryoScarless DMSO-Free (100 mL)
$131.56
Flamma® 581 ADIBO
$1100.80
Blood DNA Maxi Kit (10 Preps)
$160.00
Flamma® 581 Alkyne
$1336.00
Taq RecA protein functional
$200.98
No More Sales-NpFlamma® MMP-3,7 675
$99999.00
RuvC, Recombinant (20µg)
$416.97
qFlamma® Black01 Thiol
$3617.44
qFlamma® Black01 Biotin
$1147.84


































