Anti-Mouse ZNF862 (KIAA0543) Polyclonal Antibody, Rabbit
General information
| Cat. No. |
:FNK-MKA0543AF |
| Quantity |
:50 µg (250 µL) |
| Gene |
:mouse zinc finger protein 862 (ZNF862) (mZNF862, mKIAA0543) |
| Immunogen |
:GX0784 (GST-fusion protein, 189 amino acids)
TAWTGSTELACFGNDDILSLAKYCTLSLPAGYSEEALLKEWQSLKAATQNLLFSMLCKCALTQH
CRFPLLRRFVVVVVSVPISTSCCARGFKAMSKIRTEERTKLSNEVLDTLMMTAVNGVAVAEYDP
QPASQHWHLTSSGHRFSHIYACAREPTGFHANLGPRKEGMAGPCKEDSMAQKTSIMPSGEP |
| Format |
:Affinity Purified Rabbit IgG |
| Constitution |
:PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species |
:Mouse |
| Host Species |
:Rabbit |
| Label |
:Unlabeled |
| Cross Reactivity |
:Mouse |
| Application |
:Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
:Specific to recombinant protein GX0784. This antibody detects mZNF862 protein.
Other species have not been tested.
|
| Storage |
:Store at -20°C. Avoid freeze-thaw cycles. |
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Aliases for ZNF862 Gene
- Zinc Finger Protein 862 2 3 4 5
- KIAA0543 4
- ZNF862 5