0
Precision Quality to Your Research verified ISO 13485 Certified | SBA WOSB | NJ MWBE · NYC MWBE · Illinois BEP arrow_forward View Details

Recombinant HIV-1 Integrase (with Tag)

Product#: DCP-CSB-MP365920HKJ
$2,619.39
DCP-CSB-MP365920HKJ
Availability:
Ships In 4-6 Weeks

Recombinant HIV-1 Integrase (with Tag)

Catalog No.:  DCP-CSB-MP365920HKJ
Size:  100 ug, 1 mg


UniProt ID: P03366
Expression System: Mammalian cell
Expression Region: 1160-1447aa (Partial)
Tag information: Tag type will be determined during the manufacturing process.
Target Protein Sequence(The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence):
FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
 

Purity: Minimum 85% (per SDS-PAGE) as determined by SDS-PAGE with Coomassie Brilliant Blue staining and quantitative analysis using Bandscan software


 

Related Products

Recently Viewed

Bottomless microplate (24 Well), Plate only

$109.64

Sesaminol(1→2)Diglucoside

$416.16

Anti-Mouse SEPT6 (KIAA0128) Polyclonal Antibody, Rabbit

$495.39

Anti-Mouse ZCCHC11 (KIAA0191) Polyclonal Antibody, Rabbit

$495.39

Anti-Mouse ZNF512B (KIAA1196) Polyclonal Antibody, Rabbit

$495.39

iMatrix-511 (0.5 mg/ml solution) (2 X 175ug)

$346.79

ResiQuant CHO DNA Residue Detection Kit 2G+ (qPCR Method)

$3022.40

Potassium Acetate Buffer [1X]

$44.00

Anti-Mouse KLHL9 (KIAA1354) Polyclonal Antibody, Rabbit

$495.39

ResiQuant CHO HCP Elisa Kit 2G

$1545.60

RapidSPALM, Protein S-Palmitoylation Detection Kit

$956.80

ELISA Microplate Washer (BK-9622)

$2790.00

20µm Mesh Strainer caps for FlowTubes™

$226.83

Monkeypox Virus nucleic acid detection kit(Fluorescence PCR method)

$459.97

Protease Inhibitor Cocktail with RIPA Buffer

$165.00

TC 9639 Gradient Thermal Cycler with Multiformat Block with US Plug

$3500.00

Vacuum Filtration Systems(Product Description Page only)

$0.00

DynaMarker, DNA Low D

$192.00

OM173-alpha-A, 5 mg

$475.59

DNA, Salmon Sperm, Sonicated

$281.60

iMatrix-411 (6x175 µg)

$1849.44

MultiBox Western Blot Box with 4 Compartments

$106.56

RuvA, Recombinant  (20µg)

$416.97

Bottomless microplate (6 Well), Plate Only

$109.64

Signal Booster Immunostain (Solution M)

$243.01

Minosaminomycin: Bacterial Protein Synthesis Inhibitor

$598.00

Easy DNA Extraction Kit and DynaMarker DNA Ladder

$0.00

Electrophoresis

$0.00

[Part Only] iPhone adaptor set for microscope, for iPhone12

$1172.42

Accumax, 100 ml

$227.91

iMatrix 221 (6 X 175ug)

$1803.20

PLEASE INQUIRE! PIPA for Human TGF-β1 (100ug)

$98765.00

Adeno-Associated Virus Purification Mini Kit, All Serotypes (20 Preps)

$962.00

Sodium Acetate Buffer [3X]

$57.08

ResiQuant E.coli DNA Residue Detection Kit 2G+ (qPCR Method)

$3022.40

PLEASE INQUIRE! PIPA for Rat TGF-β1 (100ug)

$98765.00

Catechin Kit (5×10mg)

$891.71

ResiQuant Residual Host DNA Sample Pretreatment Kit

$2153.60

UltraRIPA kit for Lipid Raft (Trial) (Only 1 Per Customer)

$1.05

Pyruvate Decarboxylase YK1, Thermostable

$544.94

Hymeglusin, 1 mg

$175.41

SEM-5X (semen dilution for medium)

$112.00

Flowflex™ COVID-19 Antigen Home Test

$13.00
Satisfaction
Quality Rating
Value Rating
Style Rating

X