Anti-Mouse RPAP1 (KIAA1403) Polyclonal Antibody, Rabbit

Product#: MK14030910
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse RPAP1 (KIAA1403) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MK14030910
Quantity 50 µg (250 µL)
Gene :mouse RNA polymerase II associated protein 1 (RPAP1) (mRPAP1, mKIAA1403)
Immunogen GX0080 (GST-fusion protein, 185 amino acids)
    DLYASFLDHFEAVSFGDHLFGALVLLPLQRRFSVTLRLALFGEHVGVLRALGLPLTQLPVPLECY
    TEPAEDSLPLLQLYFRALVTGSLRARWCPILYTVAVAHVNSFIFCQDPKSSDEVKTARRSMLQR
    TWLLTDEGLRQHLLHYKLPNSSLPEGFELYSQLPRLRQQCLQTLPTEGLQNGGVKT
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
Specific to recombinant protein GX0080. This antibody detects mRPAP1 protein. Details are shown
    in the InGaP database.   Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for RPAP1 Gene

  • RNA Polymerase II Associated Protein 1 2 3 5
  • RNA Polymerase II-Associated Protein 1 3 4
  • KIAA1403 2 4
  • DKFZP727M111 2
  • FLJ12732 2
  • MGC858 2
  • RPAP1 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X