Anti-Mouse RNF31 (FLJ00217) Polyclonal Antibody, Rabbit

Product#: MFL0217AF
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse RNF31 (FLJ00217) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MFL0217AF
Quantity 50 µg (250 µL)
Gene :mouse ring finger protein 31 (mRNF31, mFLJ00217)
Immunogen GX0797 (GST-fusion protein, 157 amino acids)
    CKVKKSLHGHHPRDCLFYLRDWTAARLQKLLQDNNVMFNTEPPAGTRAVPGGGCRVMEQKE
    VHSGFRDEACGKETPPGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETATIRYLHLAPQPA
    DGEDLPAYQARLLQKLREEVPLGQSIARRRK
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
:Specific to recombinant protein GX0797. This antibody detects mRNF31 protein.
    Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for RNF31 Gene

  • Ring Finger Protein 31 2 3 5
  • HOIL-1-Interacting Protein 2 3 4
  • ZIBRA 2 3 4
  • HOIP 2 3 4
  • Zinc In-Between-RING-Finger Ubiquitin-Associated Domain Protein 3 4
  • RING-Type E3 Ubiquitin Transferase RNF31 3 4
  • E3 Ubiquitin-Protein Ligase RNF31 3 4
  • Paul 2 3
  • RING Finger Protein 31 4
  • EC 2.3.2.31 4
  • FLJ10111 2
  • FLJ23501 2
  • RNF31 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X