Anti-Mouse RNMT (KIAA0398) Polyclonal Antibody, Rabbit

Product#: MK03980910
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse RNMT (KIAA0398) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MK03980910
Quantity 50 µg (250 µL)
Gene :mouse mRNA cap guanine-N7 methyltransferase (mRNMT, mKIAA0398)
Immunogen GX0826 (GST-fusion protein, 150 amino acids)
    RLEASETESFGNEIYTVKFQKKGNYPLFGCKYDFNLEGVVDVPEFLVYFPLLTEMAKKYNMKLIY
    KKTFLEFYEEKIKNNENKMLLKRMQALEQYPAHENSKLASEKVGDYTHAAEYLKKSQVRLPLGT
    LSKSEWEATSIYLVFAFEKQQ
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Human/ Mouse 
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
Specific to recombinant protein GX0826. This antibody detects mRNMT protein. It also recognizes
    human RNMT protein. Details are shown in the InGaP database. Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for RNMT Gene

  • RNA Guanine-7 Methyltransferase 2 3 5
  • MRNA Cap Guanine-N7 Methyltransferase 2 3 4
  • RG7MT1 2 3 4
  • MRNA (Guanine-N(7)-)-Methyltransferase 3 4
  • RNA (Guanine-7-) Methyltransferase 2 3
  • MRNA Cap Methyltransferase 3 4
  • EC 2.1.1.56 4 51
  • HCMT1 3 4
  • Hcm1p 3 4
  • HMet 3 4
  • MRNA (Guanine-7-)Methyltransferase 3
  • KIAA0398 4
  • CMT1c 3
  • CMT1 3
  • Cm1p 3
  • RNMT 5
  • MET 3
  • Met 3


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X