Anti-Mouse MTMR3 (KIAA0371) Polyclonal Antibody, Rabbit

Product#: FNK-MKA0371AF
$495.39
Availability:
Ships in 1-2 Weeks

Anti-Mouse MTMR3 (KIAA0371) Polyclonal Antibody, Rabbit


General information 

Cat. No. :FNK-MKA0371AF
Quantity 50 µg (250 µL)
Gene :mouse myotubularin related protein 3 (mMTMR3, mKIAA0371)
Immunogen GX0527 (GST-fusion protein, 134 amino acids)
    GFDTLQKYPTPNGHCANWEAGRSKDSLSHQLSATSCSSAHLYSRNLHHKWLNSHSGRPSTTS
    SPDQPSRSHLDDDGMPVYTDTIQQRLRQIESGHQQEVETLKKQVQELKSRLESQYLTSSLRFN
    GDFGDEVVS
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Human/ Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
Specific to recombinant protein GX0527. This antibody detects mMTMR3 protein. It also recognizes
    human MTMR3 protein. Other species have not been tested.
Long Term Storage -20°C or below
Shipping Condition  Dry Ice 
 

Antigen Characterization 

  • Type: Primary
  • Application: Western Blot: Used for detecting specific proteins in a sample,ELISA: Employed for quantifying proteins, antibodies, and hormones in various samples.
  • Species: Human
  • Recombinant: Yes


Human Diseases

  • Breast Cancer: Upregulated in patients with triple-negative breast cancer; associated with disease recurrence and cell proliferation1.
  • IgA Nephropathy: Risk alleles enhance Toll-Like Receptor 9-induced IgA immunity, indicating a potential role in immune response2.
  • Multiple Myeloma: Involvement suggested through regulatory mechanisms involving miR-100


Cellular Signaling Pathways

  • Inositol Lipid Signaling: MTMR3 acts as an inositol lipid 3-phosphatase, regulating key phosphoinositides involved in cellular processes such as proliferation and survival1.
  • Autophagy Regulation: Depletion of MTMR3 triggers autophagosome formation, while its overexpression inhibits autophagy, impacting cell cycle progression and survival1.
  • Toll-Like Receptor Pathways: Modulates immune responses through interactions with signaling pathways activated by innate receptors


Aliases for MTMR3  Gene 

  • Myotubularin-related protein 3
  • MTM3
  • Myotubularin 3


Aliases for MTMR3 Gene

  • Myotubularin Related Protein 3 2 3 5
  • FYVE-DSP1 2 3 4
  • ZFYVE10 2 3 4
  • FYVE Domain-Containing Dual Specificity Protein Phosphatase 1 3 4
  • Phosphatidylinositol-3,5-Bisphosphate 3-Phosphatase 3 4
  • Zinc Finger FYVE Domain-Containing Protein 10 3 4
  • Phosphatidylinositol-3-Phosphate Phosphatase 3 4
  • Myotubularin-Related Protein 3 3 4
  • EC 3.1.3.48 4 51
  • KIAA0371 2 4
  • FYVE (Fab1 YGLO23 Vsp27 EEA1 Domain) Dual-Specificity Protein Phosphatase 3
  • Zinc Finger, FYVE Domain Containing 10 3
  • EC 3.1.3.95 4
  • EC 3.1.3.64 4
  • MTMR3 5
 
 

References 

  • Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
  • Wang, Zhan, et al. “MTMR3 Is Upregulated in Patients with Breast Cancer and Regulates Proliferation, Cell Cycle Progression and Autophagy in Breast Cancer Cells.” Oncology Reports, U.S. National Library of Medicine, Nov. 2019, www.ncbi.nlm.nih.gov/pmc/articles/PMC6775797/. 
  • MTMR3 Myotubularin Related Protein 3 [Homo Sapiens (Human)] - Gene - NCBI.” National Center for Biotechnology Information, U.S. National Library of Medicine, www.ncbi.nlm.nih.gov/gene?Cmd=DetailsSearch&Db=gene&Term=8897. 
  • Cell Signaling Technology. “MTMR3 Antibody.” Cell Signaling Technology, www.cellsignal.com/products/primary-antibodies/mtmr3-antibody/12443. 
  • MTMR3 Antibody: SCBT - Santa Cruz Biotechnology.” SCBT, www.scbt.com/browse/mtmr3-antibodies. Accessed 11 Oct. 2024. 
  • Novus Biologicals MTMR3 Recombinant Protein Antigen - Biochemical Reagents, Peptides.” Fisher Scientific - Part of Thermo Fisher Scientific, www.fishersci.pt/shop/products/mtmr3-recombinant-protein-antigen/18393681. 
Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X