Anti-Mouse MTMR3 (KIAA0371) Polyclonal Antibody, Rabbit

Product#: MKA0371AF
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse MTMR3 (KIAA0371) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MKA0371AF
Quantity 50 µg (250 µL)
Gene :mouse myotubularin related protein 3 (mMTMR3, mKIAA0371)
Immunogen GX0527 (GST-fusion protein, 134 amino acids)
    GFDTLQKYPTPNGHCANWEAGRSKDSLSHQLSATSCSSAHLYSRNLHHKWLNSHSGRPSTTS
    SPDQPSRSHLDDDGMPVYTDTIQQRLRQIESGHQQEVETLKKQVQELKSRLESQYLTSSLRFN
    GDFGDEVVS
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Human/ Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
Specific to recombinant protein GX0527. This antibody detects mMTMR3 protein. It also recognizes
    human MTMR3 protein. Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for MTMR3 Gene

  • Myotubularin Related Protein 3 2 3 5
  • FYVE-DSP1 2 3 4
  • ZFYVE10 2 3 4
  • FYVE Domain-Containing Dual Specificity Protein Phosphatase 1 3 4
  • Phosphatidylinositol-3,5-Bisphosphate 3-Phosphatase 3 4
  • Zinc Finger FYVE Domain-Containing Protein 10 3 4
  • Phosphatidylinositol-3-Phosphate Phosphatase 3 4
  • Myotubularin-Related Protein 3 3 4
  • EC 3.1.3.48 4 51
  • KIAA0371 2 4
  • FYVE (Fab1 YGLO23 Vsp27 EEA1 Domain) Dual-Specificity Protein Phosphatase 3
  • Zinc Finger, FYVE Domain Containing 10 3
  • EC 3.1.3.95 4
  • EC 3.1.3.64 4
  • MTMR3 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X