Anti-Mouse MTMR3 (KIAA0371) Polyclonal Antibody, Rabbit
Product#: FNK-MKA0371AF
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Mouse MTMR3 (KIAA0371) Polyclonal Antibody, Rabbit
General information
| Cat. No. | ：FNK-MKA0371AF |
| Quantity | ：50 µg (250 µL) |
| Gene | ：mouse myotubularin related protein 3 (mMTMR3, mKIAA0371) |
| Immunogen | ：GX0527 (GST-fusion protein, 134 amino acids) GFDTLQKYPTPNGHCANWEAGRSKDSLSHQLSATSCSSAHLYSRNLHHKWLNSHSGRPSTTS SPDQPSRSHLDDDGMPVYTDTIQQRLRQIESGHQQEVETLKKQVQELKSRLESQYLTSSLRFN GDFGDEVVS |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Human/ Mouse |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX0527. This antibody detects mMTMR3 protein. It also recognizes
human MTMR3 protein. Other species have not been tested. |
| Long Term Storage | ：-20°C or below |
| Shipping Condition | ：Dry Ice |
Antigen Characterization
- Type: Primary
- Application: Western Blot: Used for detecting specific proteins in a sample,ELISA: Employed for quantifying proteins, antibodies, and hormones in various samples.
- Species: Human
- Recombinant: Yes
Human Diseases
- Breast Cancer: Upregulated in patients with triple-negative breast cancer; associated with disease recurrence and cell proliferation1.
- IgA Nephropathy: Risk alleles enhance Toll-Like Receptor 9-induced IgA immunity, indicating a potential role in immune response2.
- Multiple Myeloma: Involvement suggested through regulatory mechanisms involving miR-100
Cellular Signaling Pathways
- Inositol Lipid Signaling: MTMR3 acts as an inositol lipid 3-phosphatase, regulating key phosphoinositides involved in cellular processes such as proliferation and survival1.
- Autophagy Regulation: Depletion of MTMR3 triggers autophagosome formation, while its overexpression inhibits autophagy, impacting cell cycle progression and survival1.
- Toll-Like Receptor Pathways: Modulates immune responses through interactions with signaling pathways activated by innate receptors
Aliases for MTMR3 Gene
- Myotubularin-related protein 3
- MTM3
- Myotubularin 3
Aliases for MTMR3 Gene
- Myotubularin Related Protein 3 2 3 5
- FYVE-DSP1 2 3 4
- ZFYVE10 2 3 4
- FYVE Domain-Containing Dual Specificity Protein Phosphatase 1 3 4
- Phosphatidylinositol-3,5-Bisphosphate 3-Phosphatase 3 4
- Zinc Finger FYVE Domain-Containing Protein 10 3 4
- Phosphatidylinositol-3-Phosphate Phosphatase 3 4
- Myotubularin-Related Protein 3 3 4
- EC 3.1.3.48 4 51
- KIAA0371 2 4
- FYVE (Fab1 YGLO23 Vsp27 EEA1 Domain) Dual-Specificity Protein Phosphatase 3
- Zinc Finger, FYVE Domain Containing 10 3
- EC 3.1.3.95 4
- EC 3.1.3.64 4
- MTMR3 5
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
- Wang, Zhan, et al. “MTMR3 Is Upregulated in Patients with Breast Cancer and Regulates Proliferation, Cell Cycle Progression and Autophagy in Breast Cancer Cells.” Oncology Reports, U.S. National Library of Medicine, Nov. 2019, www.ncbi.nlm.nih.gov/pmc/articles/PMC6775797/.
- MTMR3 Myotubularin Related Protein 3 [Homo Sapiens (Human)] - Gene - NCBI.” National Center for Biotechnology Information, U.S. National Library of Medicine, www.ncbi.nlm.nih.gov/gene?Cmd=DetailsSearch&Db=gene&Term=8897.
- Cell Signaling Technology. “MTMR3 Antibody.” Cell Signaling Technology, www.cellsignal.com/products/primary-antibodies/mtmr3-antibody/12443.
- MTMR3 Antibody: SCBT - Santa Cruz Biotechnology.” SCBT, www.scbt.com/browse/mtmr3-antibodies. Accessed 11 Oct. 2024.
- Novus Biologicals MTMR3 Recombinant Protein Antigen - Biochemical Reagents, Peptides.” Fisher Scientific - Part of Thermo Fisher Scientific, www.fishersci.pt/shop/products/mtmr3-recombinant-protein-antigen/18393681.
Recently Viewed
SC Complete Agar Plate
$75.00
TBS Blocking Buffer with PVP
$27.50
77002 Binocular Surgical Microscope
$6016.00
96 Well ELISA Plates
$0.00
Flamma® 496 ADIBO
$1100.80
