Anti-Mouse LARP5 (KIAA0217) Polyclonal Antibody, Rabbit

Product#: MKA0217AF
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse LARP5 (KIAA0217) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MKA0217AF
Quantity 50 µg (250 µL)
Gene :mouse La ribonucleoprotein domain family, member 5 (mLARP5, mKIAA0217)
Immunogen GX1366 (GST-fusion protein, 193 amino acids)
    EDLFENRLSSLIIGSSKERNLSTDASTNTVPVVGPREPSVPAPCAVSAAFERSPSPVHLPEDPKV
    AEKQRETQSVDRLPSTPTTTACKSVQVNGAATELRKPSYAEICQRTSKDPSSSSPLQPPKEQK
    PSTVACGKEEKRLSEPVERHREPPALKSTPGVPKDQRRQPGRRASPPAAGKRLSKEQNTPPK
    SPQ
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Human/ Mouse 
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
Specific to recombinant protein GX1366. This antibody detects mLARP5 protein. It also recognizes
    human LARP5 protein.  Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for LARP4B Gene

  • La Ribonucleoprotein 4B 2 3 5
  • La Ribonucleoprotein Domain Family Member 4B 2 3 4
  • KIAA0217 2 3 4
  • La Ribonucleoprotein Domain Family, Member 5 2 3
  • La-Related Protein 4B 3 4
  • La-Related Protein 5 3 4
  • LARP5 3 4
  • La Ribonucleoprotein Domain Family, Member 4B 2
  • La Ribonucleoprotein Domain Family Member 5 4
  • LARP4B 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X