Anti-Mouse CNKSR2 (KIAA0902) Polyclonal Antibody, Rabbit

Product#: FNK-MK09020910

$495.39

Qty:

Availability:

Ships in 1-2 Weeks

Anti-Mouse CNKSR2 (KIAA0902) Polyclonal Antibody, Rabbit

General information

Cat. No.	：FNK-MK09020910
Quantity	：50 µg (250 µL)
Gene	：mouse Connector enhancer of kinase suppressor of Ras 2 (CNKSR2) (mCNKSR2, mKIAA0902)
Immunogen	：GX0244 (GST-fusion protein, 171 amino acids) VSACDPQDDIQPPEVEEEEEEEEEEAAGENVGEKNENREEKLGDSLQDLYRALEEASLSPLGE HRISTKMEYKLSFIKRCNDPVMNEKLHRLRILKSTLKAREGEVAIIDKVLDNPDLTSKEFQQWKQ MYLDLFLDICQSTTSNDPLSISSEVDVLTSSLTHTHSYIETHV
Format	：Affinity Purified Rabbit IgG
Constitution	：PBS containing with 50% glycerol and 0.02% of NaN₃
Antigen Species	：Mouse
Host Species	：Rabbit
Label	：Unlabeled
Cross Reactivity	：Mouse
Application	：Western blotting (1 : 1,000), Other applications have not been tested.
Specificity	：Specific to recombinant protein GX0244. This antibody detects mCNKSR2 protein. Details are shown in the InGaP database. Other species have not been tested.
Storage	：Store at -20°C. Avoid freeze-thaw cycles.
Shipping Condition	：Dry Ice

Antigen Characterization

Human Diseases

CNKSR2-Related Neurodevelopmental Disorders: Associated with developmental delays, intellectual disabilities, and epilepsy due to loss-of-function mutations in the CNKSR2 gene.
Seizures: Commonly observed in affected individuals, often linked to specific pathogenic variants.
Autism Spectrum Disorder: Some cases exhibit features consistent with autism alongside other neurodevelopmental issues.

Cellular Signaling Pathways

Ras Signaling Pathway: CNKSR2 acts as a scaffold protein that enhances Ras signaling, crucial for cell growth and differentiation.
Neuronal Development: Involved in pathways that mediate neuronal differentiation and synaptic plasticity, impacting brain development.
Regulation of MAPK Pathways: Plays a role in modulating MAPK signaling, affecting cellular responses to growth factors.

Aliases for CNKSR2 Gene

References

Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Erata, Eda, et al. “CNKSR2 Loss in Mice Leads to Increased Neural Activity and Behavioral Phenotypes of Epilepsy-Aphasia Syndrome.” The Journal of Neuroscience?: The Official Journal of the Society for Neuroscience, U.S. National Library of Medicine, 17 Nov. 2021, www.ncbi.nlm.nih.gov/pmc/articles/PMC8612478/.
Li, Guangxiao, et al. “CNKSR2 Expression Is Correlated with Immune Infiltrates in Cervical Cancer as a Favorable Prognostic Factor.” Journal of Cancer, Ivyspring International Publisher, 1 Jan. 2024, www.jcancer.org/v15p0444.htm.
Ito, Hidenori, and Koh-Ichi Nagata. “Functions of CNKSR2 and Its Association with Neurodevelopmental Disorders.” Cells, U.S. National Library of Medicine, 17 Jan. 2022, www.ncbi.nlm.nih.gov/pmc/articles/PMC8774548/.
Higa, Leigh Ann, et al. “CNKSR2-Related Neurodevelopmental and Epilepsy Disorder: A Cohort of 13 New Families and Literature Review Indicating a Predominance of Loss of Function Pathogenic Variants - BMC Medical Genomics.” BioMed Central, BioMed Central, 15 July 2021, bmcmedgenomics.biomedcentral.com/articles/10.1186/s12920-021-01033-7.