Anti-Mouse ZFYVE1 (KIAA1589) Polyclonal Antibody, Rabbit
General information
| Cat. No. | :FNK-MKA1589AF |
| Quantity | :50 µg (250 µL) |
| Gene | :mouse zinc finger, FYVE domain containing 1 (mZFYVE1, mKIAA1589) |
| Immunogen | :GX0912 (GST-fusion protein, 164 amino acids) GYVIECPNCGVVYRSRQYWFGNQDPVDTVVRTEIVHVWPGTDAFLKDNNNAAQRLLDGMNFM AQSVSELSLGPTKAVTSWLTDQIAPAYWRPNSQILSCNQCATSFKDNDTKHHCRACGEGFCDS CSSKTRPVPERGWGPAPVRVCDSCYDARNVQLDVTEAGR |
| Format | :Affinity Purified Rabbit IgG |
| Constitution | :PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | :Mouse |
| Host Species | :Rabbit |
| Label | :Unlabeled |
| Cross Reactivity | :Human/ Mouse |
| Application | :Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
:Specific to recombinant protein GX0912. This antibody detects mZFYVE1 protein. It also recognizes
human ZFYVE1 protein. Other species have not been tested. |
| Storage | :Store at -20°C. Avoid freeze-thaw cycles. |
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Aliases for ZFYVE1 Gene
- Zinc Finger FYVE-Type Containing 1 2 3 5
- DFCP1 2 3 4
- TAFF1 2 3 4
- Protein Phosphatase 1, Regulatory Subunit 172 2 3
- Zinc Finger FYVE Domain-Containing Protein 1 3 4
- Zinc Finger, FYVE Domain Containing 1 2 3
- Double FYVE-Containing Protein 1 3 4
- PPP1R172 2 3
- KIAA1589 2 4
- ZNFN2A1 3 4
- SR3 3 4
- Zinc Finger Protein, Subfamily 2A (FYVE Domain Containing), 1 2
- Zinc Finger Protein, Subfamily 2A, Member 1 3
- Phosphoinositide-Binding Protein SR3 3
- Tandem FYVE Fingers-1 Protein 3
- Tandem FYVE Fingers-1 4
- ZFYVE1 5













