Anti-Mouse MED24 (KIAA0130) Polyclonal Antibody, Rabbit
General information
| Cat. No. | :FNK-MKA0130AF |
| Quantity | :50 µg (250 µL) |
| Gene | :mouse septin 6 (mMED24, mKIAA0130) |
| Immunogen | :GX2035 (GST-fusion protein, 199 amino acids) LLTDSSKWHSLMDPPGTALAKLAVWCALSSYSSHKGQASSRQKKRHREDIEDYVSLFPVEDM QPSKLMRLLSSSDDDANILSSPTDRSMNSSLSASQLHTVNMRDPLNRVLANLFLLISSILGSRTA GPHTQFVQWFMEECVGCLEQDSRGSILQFMPFTTVSELVKVSAMSSPKVVLAITDLSLPLGRQ VAAKAIAAL |
| Format | :Affinity Purified Rabbit IgG |
| Constitution | :PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | :Mouse |
| Host Species | :Rabbit |
| Label | :Unlabeled |
| Cross Reactivity | :Human/ Mouse |
| Application | :Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
:Specific to recombinant protein GX2035. This antibody detects mMED24 protein. It also recognizes
human MED24 protein. Other species have not been tested. |
| Long Term Storage | :-20°C or below |
| Shipping Condition | :Dry Ice |
Antigen Characterization
- Type: Primary
- Application: ELISA (Enzyme-Linked Immunosorbent Assay),Western Blot
- Species: Human
- Recombinant: Yes
Human Diseases
- Toxocariasis: A parasitic infection caused by Toxocara species, leading to symptoms such as fever, cough, and abdominal pain. The antigenMED24 may be involved in serological detection of this disease.
- HIV: The antigen is used in tests to detect HIV infection, which can lead to AIDS if untreated. Early diagnosis is crucial for effective management and treatment.
Cellular Signaling Pathways
- Immune Response Activation: Antigen recognition by immune cells triggers signaling pathways that activate T-cells and B-cells, leading to antibody production.
- Cytokine Production: Interaction with the antigen can stimulate the release of cytokines, which modulate immune responses and inflammation.
Aliases for MED24 Gene
- Mediator Complex Subunit 24 2 3 4 5
- DRIP100 2 3 4
- TRAP100 2 3 4
- Cofactor Required For Sp1 Transcriptional Activation, Subunit 4, 100kDa 2 3
- Thyroid Hormone Receptor-Associated Protein Complex 100 KDa Component 3 4
- Vitamin D3 Receptor-Interacting Protein Complex 100 KDa Component 3 4
- Cofactor Required For Sp1 Transcriptional Activation Subunit 4 3 4
- Mediator Of RNA Polymerase II Transcription Subunit 24 3 4
- Activator-Recruited Cofactor 100 KDa Component 3 4
- Thyroid Hormone Receptor-Associated Protein 4 3 4
- CRSP Complex Subunit 4 3 4
- KIAA0130 2 4
- CRSP100 2 3
- ARC100 3 4
- THRAP4 3 4
- CRSP4 3 4
- MED5 2 3
- Vitamin D3 Receptor-Interacting Protein Complex Component DRIP100 3
- Mediator Of RNA Polymerase II Transcription, Subunit 24 Homolog 3
- Thyroid Hormone Receptor Associated Protein 4 2
- HTRAP100 4
- Trap100 4
- MED24 5
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
- Dullovi, Arlinda, et al. “Microtubule-Associated Proteins MAP7 and MAP7D1 Promote DNA Double-Strand Break Repair in the G1 Cell Cycle Phase.” iScience, U.S. National Library of Medicine, 1 Feb. 2023, www.ncbi.nlm.nih.gov/pmc/articles/PMC9958362/.
- MAP7D1 Antibodies from Thermo Fisher Scientific.” Anti-MAP7D1 Antibodies | Invitrogen, 12 Feb. 2023, www.thermofisher.com/antibody/primary/target/map7d1.
- MAP7D1 Protein Expression Summary - the Human Protein Atlas, www.proteinatlas.org/ENSG00000116871-MAP7D1.
- MAP7D1 MAP7 Domain Containing 1 [Homo Sapiens (Human)] - Gene - NCBI.” National Center for Biotechnology Information, U.S. National Library of Medicine, www.ncbi.nlm.nih.gov/gene?Cmd=DetailsSearch&Db=gene&Term=55700.

Related Products
Recently Viewed
BSA, Flamma® 675
$466.87
Plant RNA Maxi Kit (10 Preps)
$120.00
BSA, Flamma® 774
$466.87
Plant RNA Mega Kit (10 Preps)
$700.00






