Anti-Mouse GPD1L (KIAA0089) Polyclonal Antibody, Rabbit
General information
| Cat. No. |
:FNK-MK00890310 |
| Quantity |
:100 µg (200 µL) |
| Gene |
:mouse glycerol-3-phosphate dehydrogenase 1-like (mGPD1L, mKIAA0089) |
| Immunogen |
:GX2087 (GST-fusion protein, 173 amino acids)
FKELLQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAFAKIF
CKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTGKTIEELEKELLNGQKLQGPQTSAEV
YRILRQKGLLDKFPLFTAVYQICYEGRPVTQMLSCLQSHPEHI |
| Format |
:Rabbit IgG purified with Protein A affinity chromatography. |
| Constitution |
:PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species |
:Mouse |
| Host Species |
:Rabbit |
| Label |
:Unlabeled |
| Cross Reactivity |
:Mouse |
| Application |
:Western blotting (1 : 1,000), Immunoprecipitation. Other applications have not been tested. |
| Specificity |
:Specific to recombinant protein GX2087. This antibody detects endogenous mGPD1L protein in
several tissues. It also recognizes human GPD1L protein. Other species have not been tested.
|
| Storage |
:Store at -20°C. Avoid freeze-thaw cycles. |
Anti-Mouse GPD1L (KIAA0089)

Western blot analysis
- Adult Mouse Tissues -
- 1:Heart, 2:Lung, 3:Liver, 4:Muscle, 5:Kidney, 6:Testis, 7:Pancreas, 8:Thymus, 9:Spleen, 10:Brain, 11:Prostate.
- Cell Lines -
- 12:B16 cells, 13:F9 cells, 14:Neuro2A cells.
References
- Hara, Y. et al.: DNA Res., 10, 129 (2003).
- Koga, H. et al.: DNA Res., 11, 293 (2004).
- Carninci, P. et al.: Science, 309, 1559 (2005).
Aliases for GPD1L Gene
- Glycerol-3-Phosphate Dehydrogenase 1 Like 2 3 5
- Glycerol-3-Phosphate Dehydrogenase 1-Like Protein 3 4
- EC 1.1.1.8 4 51
- KIAA0089 2 4
- GPD1-L 3 4
- EC 1.1.1 51
- GPD1L 5