Anti-Mouse GPD1L (KIAA0089) Polyclonal Antibody, Rabbit

Product#: MK00890310
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse GPD1L (KIAA0089) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MK00890310
Quantity 100 µg (200 µL)
Gene :mouse glycerol-3-phosphate dehydrogenase 1-like (mGPD1L, mKIAA0089)
Immunogen GX2087 (GST-fusion protein, 173 amino acids)
    FKELLQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAFAKIF
    CKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTGKTIEELEKELLNGQKLQGPQTSAEV
    YRILRQKGLLDKFPLFTAVYQICYEGRPVTQMLSCLQSHPEHI
Format Rabbit IgG purified with Protein A affinity chromatography.
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Immunoprecipitation. Other applications have not been tested.
Specificity
Specific to recombinant protein GX2087. This antibody detects endogenous mGPD1L protein in
    several tissues. It also recognizes human GPD1L protein.     Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

Anti-Mouse GPD1L (KIAA0089)
MK00890310_fig1.png

Western blot analysis

  • Adult Mouse Tissues -
    • 1:Heart, 2:Lung, 3:Liver, 4:Muscle, 5:Kidney, 6:Testis, 7:Pancreas, 8:Thymus, 9:Spleen, 10:Brain, 11:Prostate.
  • Cell Lines -
    • 12:B16 cells, 13:F9 cells, 14:Neuro2A cells.



References

  1. Hara, Y. et al.: DNA Res., 10, 129 (2003).
  2. Koga, H. et al.: DNA Res., 11, 293 (2004).
  3. Carninci, P. et al.: Science, 309, 1559 (2005). 
 

Aliases for GPD1L Gene

  • Glycerol-3-Phosphate Dehydrogenase 1 Like 2 3 5
  • Glycerol-3-Phosphate Dehydrogenase 1-Like Protein 3 4
  • EC 1.1.1.8 4 51
  • KIAA0089 2 4
  • GPD1-L 3 4
  • EC 1.1.1 51
  • GPD1L 5


Logo_proteinexpress.png
 
 

Satisfaction
Quality Rating
Value Rating
Style Rating
X