Anti-Mouse GPD1L (KIAA0089) Polyclonal Antibody, Rabbit
General information
| Cat. No. | :FNK-MK00890310 |
| Quantity | :100 µg (200 µL) |
| Gene | :mouse glycerol-3-phosphate dehydrogenase 1-like (mGPD1L, mKIAA0089) |
| Immunogen | :GX2087 (GST-fusion protein, 173 amino acids) FKELLQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAFAKIF CKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTGKTIEELEKELLNGQKLQGPQTSAEV YRILRQKGLLDKFPLFTAVYQICYEGRPVTQMLSCLQSHPEHI |
| Format | :Rabbit IgG purified with Protein A affinity chromatography. |
| Constitution | :PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | :Mouse |
| Host Species | :Rabbit |
| Label | :Unlabeled |
| Cross Reactivity | :Mouse |
| Application | :Western blotting (1 : 1,000), Immunoprecipitation. Other applications have not been tested. |
| Specificity |
:Specific to recombinant protein GX2087. This antibody detects endogenous mGPD1L protein in
several tissues. It also recognizes human GPD1L protein. Other species have not been tested. |
| Storage | :Store at -20°C. Avoid freeze-thaw cycles. |
Western blot analysis
- Adult Mouse Tissues -
- 1:Heart, 2:Lung, 3:Liver, 4:Muscle, 5:Kidney, 6:Testis, 7:Pancreas, 8:Thymus, 9:Spleen, 10:Brain, 11:Prostate.
- Cell Lines -
- 12:B16 cells, 13:F9 cells, 14:Neuro2A cells.
References
- Hara, Y. et al.: DNA Res., 10, 129 (2003).
- Koga, H. et al.: DNA Res., 11, 293 (2004).
- Carninci, P. et al.: Science, 309, 1559 (2005).
Aliases for GPD1L Gene

Related Products
Recently Viewed
Plasmid Maxi Kit (10 Preps)
$120.00
DynaMarker, RNA Low II
$322.92
Plasmid Midi Kit I (2 Preps)
$18.00
Accutase, 100 ml
$76.68
DynaMarker, RNA Low II Easy Load
$322.92
Flamma® 496 Maleimide
$1100.80
iMatrix-411 (6x175 µg)
$1849.44
GN8K DNA Marker (500 uL)
$653.00
FSD Fluor™ 594 Phalloidin
$845.54

































