Anti-Mouse FOXJ3 (KIAA1041) Polyclonal Antibody, Rabbit

Product#: MKA1041AF
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse FOXJ3 (KIAA1041) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MKA1041AF
Quantity 50 µg (250 µL)
Gene :mouse forkhead box J3 (mFOXJ3, mKIAA1041)
Immunogen GX2004 (GST-fusion protein, 225 amino acids)
    QHPAPHPQQHSQLQPPHSQHPPPHQHIQHHPNHQHQTLAHQPPPPPQQVSCNSGVSSDWYA
    TLDMLKESCRIASSVNWSDVDLSQFQGLMESMRQADLKNWSLDQVQFADLCSSLNQFFTQTG
    LIHSQSNVPQNVCHGAMHPAKPSQHIGAGNLYIDSRQSLPPSVMPPPGYPHIPQALNTPGTTM
    AGHHGAMNQQHMMPSQAFPMRRPLPPDDIQDDFDWDSIV
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Human/ Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
Specific to recombinant protein GX2004. This antibody detects mFOXJ3 protein. It also recognizes
    human FOXJ3 protein.  Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for FOXJ3 Gene

  • Forkhead Box J3 2 3 5
  • Forkhead Box Protein J3 3 4
  • KIAA1041 2 4
  • FOXJ3 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X