Anti-Mouse FDPS (KIAA1293) Polyclonal Antibody, Rabbit
General information
| Cat. No. |
:FNK-MK12930505 |
| Quantity |
:50 µg (250 µL) |
| Gene |
:mouse farnesyl diphosphate synthetase, FDPS (mFDPS, mKIAA1293) |
| Immunogen |
:GX0577 (GST-fusion protein, 116 amino acids)
FFQVQDDYLDLFGDPSVTGKVGTDIQDNKCSWLVVQCLLRASPQQRQILEENYGQKDPEKVAR
VKALYEALDLQSAFFKYEEDSYNRLKSLIEQCSAPLPPSIFMELANKIYKRRK |
| Format |
:Affinity Purified Rabbit IgG |
| Constitution |
:PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species |
:Mouse |
| Host Species |
:Rabbit |
| Label |
:Unlabeled |
| Cross Reactivity |
:Human/ Mouse |
| Application |
:Western blotting (1 : 1,000), Immunohistochemistry (frozen sections, paraffin-embedded sections),
Immunoprecipitation. Other applications have not been tested. |
| Specificity |
:Specific to recombinant protein GX0577. This antibody detects mFDPS protein. It also recognizes
human FDPS protein. Details are shown in the InGaP database. Other species have not been tested.
|
| Storage |
:Store at -20°C. Avoid freeze-thaw cycles. |