Anti-Mouse FBXO28 (KIAA0483) Polyclonal Antibody, Rabbit

Product#: MKA0483AF
$577.00
Availability:
Ships in 1-2 weeks

Anti-Mouse FBXO28 (KIAA0483) Polyclonal Antibody, Rabbit


General information 

Cat. No. :MKA0483AF
Quantity 50 µg (250 µL)
Gene :mouse F-box only protein 28 (FBXO28) (mFBXO28, mKIAA0483)
Immunogen GX0462 (GST-fusion protein, 104 amino acids)
    QQQVRTNGAGVTVLRREISELRTKVQEQQKQLQDQDQKLLEQTQIIGEQNARLAELERKLREV
    MESAVGTSSGSGQSEESPRKRRKATEAIDSLRKSKRLRNRK
Format Affinity Purified Rabbit IgG
Constitution :PBS containing with 50% glycerol and 0.02% of NaN3
Antigen Species :Mouse
Host Species Rabbit 
Label Unlabeled
Cross Reactivity :Mouse
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
:Specific to recombinant protein GX0462. This antibody detects mFBXO28 protein.
    Other species have not been tested.
Storage Store at -20°C. Avoid freeze-thaw cycles.
 

References

  1. Okazaki,N. et al.: DNA Res., 10(1), 35 (2003). 
 

Aliases for FBXO28 Gene

  • F-Box Protein 28 2 3 5
  • CENP-30 2 3 4
  • Centromere Protein 30 2 3
  • F-Box Only Protein 28 3 4
  • KIAA0483 2 4
  • Fbx28 2 3
  • FLJ10766 2
  • FBXO28 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X