Anti-Mouse EPB41L1 (KIAA0338) Polyclonal Antibody, Rabbit
General information
| Cat. No. |
:FNK-MK03380505 |
| Quantity |
:50 µg (250 µL) |
| Gene |
:mouse neuronal protein 4.1 (mEPB41L1, mKIAA0338) |
| Immunogen |
:GX0161 (GST-fusion protein, 221 amino acids)
QDLKGPSSQEDESGGLEDSPDRGACSTPEMPQFESVKAETMTVSSLAIRKKIEPEAMLQSRVS
AADSTQVDGGTPMVKDFMTTPPCITTETISTTMENSLKSGKGAAAMIPGPQTVATEIRSLSPIIGK
DVLTSTYGATAETLSTSTTTHVTKTVKGGFSETRIEKRIIITGDEDVDQDQALALAIKEAKLQHPD
MLVTKAVVYRETDPSPEERDKKPQES |
| Format |
:Affinity Purified Rabbit IgG |
| Constitution |
:PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species |
:Mouse |
| Host Species |
:Rabbit |
| Label |
:Unlabeled |
| Cross Reactivity |
:Human/ Mouse |
| Application |
:Western blotting (1 : 1,000), Immunohistochemistry (frozen sections), Immunoprecipitation.
Other applications have not been tested. |
| Specificity |
:Specific to recombinant protein GX0161. This antibody detects mEPB41L1 protein. It also recognizes
human EPB41L1 protein. Details are shown in the InGaP database. Other species have not been tested.
|
| Storage |
:Store at -20°C. Avoid freeze-thaw cycles. |
 |
Western blot analysis
Adult Mouse Tissues -
1:Heart, 2:Lung, 3:Liver, 4:Muscle, 5:Kidney,
6:Testis, 7:Pancreas, 8:Thymus, 9:Spleen,
10:Brain, 11:Prostate.
Cell Lines -
12:B16 cells, 13:F9 cells, 14:Neuro2A cells.
|
References
- Hara, Y. et al.: DNA Res., 10, 129 (2003).
- Koga, H. et al.: DNA Res., 11, 293 (2004).
- Walensky, L.D. et al.: J. Neurosci., 19, 6457 (1999).
- Zhang, S. et al.: J. Biol. Chem., 278, 4048 (2003).
- Fukatsu, K. et al.: J. Biol. Chem., 279, 48976 (2004).
Aliases for EPB41L1FBXO28 Gene
- Erythrocyte Membrane Protein Band 4.1 Like 1 2 3 5
- 4.1N 2 3 4
- Band 4.1-Like Protein 1 3 4
- Neuronal Protein 4.1 3 4
- KIAA0338 2 4
- Neuron-Type Nonerythroid Protein 4.1 3
- EPB41L1 5
- MRD11 3