Anti-Mouse ATG2A (KIAA0404) Polyclonal Antibody, Rabbit
Product#: FNK-MKA0404AF
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Mouse ATG2A (KIAA0404) Polyclonal Antibody, Rabbit
General information
| Cat. No. | ：FNK-MKA0404AF |
| Quantity | ：50 µg (250 µL) |
| Gene | ：mouse ATG2 autophagy related 2 homolog A (mATG2A, mKIAA0404) |
| Immunogen | ：GX0890 (GST-fusion protein, 213 amino acids) CYALNEWLQDIRKNQLPGLLGGVGPMHSVVQLFQGFRDLLWLPIEQYRKDGRLIRGLQRGAAS FGSSTASAALELSNRLVQAIQATAETVYDILSPASPVSRSLQDKRSSRKLRRGQQPADLREGMA KAYDAVREGILDTAQTICDVASRGHEQKGLTGAVGGVIRQLPPTVVKPIIVATEATSNVLGGMRN QILPDAHKDHALKWRLEEAQD |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Mouse |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX0890. This antibody detects mATG2A protein.
Other species have not been tested. |
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Antigen Characterization
| Type | ：Autophagy-related protein |
| Application | ：Western Blot, Immunoprecipitation, Immunofluorescence |
| Species | ：Human, Mouse, Rat |
| Recombinant | ：Yes |
ATG2A in the Cell
- Plays a crucial role in the cellular process of autophagy
- Involved in the formation and expansion of autophagosomes
- Facilitates the transfer of lipids to growing autophagosomal membranes
- Interacts with the endoplasmic reticulum and lipid droplets
- Suggests a role in lipid metabolism and membrane dynamics
- Essential for maintaining cellular homeostasis
- Helps remove damaged organelles, protein aggregates, and other cellular debris
ATG2A in the Human Body
- Contributes to various physiological processes through its role in autophagy
- Important for cellular adaptation to stress, nutrient deprivation, and infection
- Supports immune responses
- Helps maintain neuronal health
- Contributes to the body's ability to combat certain diseases
- Influences energy homeostasis and metabolic health through its role in lipid metabolism
- Dysregulation implicated in several pathological conditions, including:
- Neurodegenerative diseases
- Certain cancers
- Significant in maintaining overall human health and disease prevention
Aliases for ATG2A Gene
Recently Viewed
(2R,3R)-SDG,from Flaxseed
$462.38
Orlistat, 100 mg
$285.03
Amyloglucosidase, Thermostable
$354.22
Yeast Plasmid Kit (250 Preps)
$265.00
CopyPlate 96-1/2 for petri dish
$693.56
