Anti-Human TNRC4 Polyclonal Antibody, Rabbit

Product#: FNK-KB7008GNPAF
$495.39
Availability:
Ships in 1-2 Weeks

Anti-Human TNRC4 Polyclonal Antibody, Rabbit


General information 

Cat. No. :FNK-KB7008GNPAF
Quantity :50 µg (250 µL)
Gene :TNRC4 (CUG-BP- and ETR-3-like factor 3, CELF-3, Bruno-like protein 1, RNA-binding protein BRUNOL-1,
    ELAV-type RNA-binding protein 1, ETR-1, Trinucleotide repeat-containing gene 4 protein, Expanded repeat
    domain protein CAG/CTG 4, CAG repeat protein 4)
Immunogen :GX5067 (GST-fusion protein, 167 amino acids)
    MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQS
    ALHEQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRG
    PDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSS
Format :Affinity Purified Rabbit IgG
Constitution :PBS containing with 40% glycerol and 0.02% of NaN3
Antigen Species :Human 
Host Species :Rabbit 
Label :Unlabeled
Cross Reactivity :Human 
Application   :Western blotting (1 : 1,000), Other applications have not been tested.
Specificity
:This antibody detects human TNRC4 protein. Other species have not been tested.
Storage :Store at -20°C. Avoid freeze-thaw cycles.
 

Aliases for CELF3 Gene

  • CUGBP Elav-Like Family Member 3 2 3 4 5
  • BRUNOL1 2 3 4
  • CAGH4 2 3 4
  • ERDA4 2 3 4
  • Trinucleotide Repeat-Containing Gene 4 Protein 3 4
  • Expanded Repeat Domain Protein CAG/CTG 4 3 4
  • Expanded Repeat Domain, CAG/CTG 4 2 3
  • Trinucleotide Repeat Containing 4 2 3
  • CUG-BP- And ETR-3-Like Factor 3 3 4
  • ELAV-Type RNA-Binding Protein 1 3 4
  • RNA-Binding Protein BRUNOL-1 3 4
  • CAG Repeat Protein 4 3 4
  • Bruno-Like Protein 1 3 4
  • CAG Repeat Domain 2 3
  • ETR-1 3 4
  • TNRC4 3 4
  • CUGBP, Elav-Like Family Member 3 2
  • CUG-BP And ETR-3 Like Factor 3 2
  • MGC57297 2
  • CELF-3 4
  • CELF3 5


Logo_proteinexpress.png

Satisfaction
Quality Rating
Value Rating
Style Rating
X