Anti-Human TNRC4 Polyclonal Antibody, Rabbit
General information
| Cat. No. | :FNK-KB7008GNPAF |
| Quantity | :50 µg (250 µL) |
| Gene | :TNRC4 (CUG-BP- and ETR-3-like factor 3, CELF-3, Bruno-like protein 1, RNA-binding protein BRUNOL-1, ELAV-type RNA-binding protein 1, ETR-1, Trinucleotide repeat-containing gene 4 protein, Expanded repeat domain protein CAG/CTG 4, CAG repeat protein 4) |
| Immunogen | :GX5067 (GST-fusion protein, 167 amino acids) MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQS ALHEQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRG PDGTSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSS |
| Format | :Affinity Purified Rabbit IgG |
| Constitution | :PBS containing with 40% glycerol and 0.02% of NaN3 |
| Antigen Species | :Human |
| Host Species | :Rabbit |
| Label | :Unlabeled |
| Cross Reactivity | :Human |
| Application | :Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
:This antibody detects human TNRC4 protein. Other species have not been tested.
|
| Storage | :Store at -20°C. Avoid freeze-thaw cycles. |
Aliases for CELF3 Gene
- CUGBP Elav-Like Family Member 3 2 3 4 5
- BRUNOL1 2 3 4
- CAGH4 2 3 4
- ERDA4 2 3 4
- Trinucleotide Repeat-Containing Gene 4 Protein 3 4
- Expanded Repeat Domain Protein CAG/CTG 4 3 4
- Expanded Repeat Domain, CAG/CTG 4 2 3
- Trinucleotide Repeat Containing 4 2 3
- CUG-BP- And ETR-3-Like Factor 3 3 4
- ELAV-Type RNA-Binding Protein 1 3 4
- RNA-Binding Protein BRUNOL-1 3 4
- CAG Repeat Protein 4 3 4
- Bruno-Like Protein 1 3 4
- CAG Repeat Domain 2 3
- ETR-1 3 4
- TNRC4 3 4
- CUGBP, Elav-Like Family Member 3 2
- CUG-BP And ETR-3 Like Factor 3 2
- MGC57297 2
- CELF-3 4
- CELF3 5

Related Products
Recently Viewed
HRPQuench-PBS
$141.90
TDzyme® TM Pack
$1.00
D-Iditol, ≧99%
$439.27
Ampicillin Solution
$0.00
Enzymes
$0.00
PETG Erlenmeyer Flasks
$0.00
Anti-HBs Pre-S2, Poly
$346.78
Stem Cell Related
$0.00
BioMasher Sterile
$0.00
Cell Culture Substrate
$0.00
















