0
Precision Quality to Your Research verified ISO 13485 Certified | SBA WOSB | NJ MWBE · NYC MWBE · Illinois BEP arrow_forward View Details

Anti-ZBTB7B, Human, Rabbit-Poly

Product#: FNK-KB7052GNP
$297.23
Availability:
Ships in 48 hours

Anti-ZBTB7B, Human, Rabbit-Poly



Cat. No.:  FNK-KB7052GNP

Size: 100μL

Storage: -20°C. Avoid freeze-thaw cycles.


Antigen Species: Human

Host Species: Rabbit

Cross Reactivity: Human

Label: Unlabeled

Purification: Serum

 

Specifications


Gene: ZBTB7B (Zinc finger and BTB domain-containing protein 7B, Zinc finger protein 67 homolog, Zfp-67, Zinc finger and BTB domain-containing protein 15, Zinc finger protein Th-POK, T-helper-inducing POZ/Krueppel-like factor, Krueppel-related zinc finger protein cKrox, hcKrox)

Immunogen: GX5219 (GST-fusion protein, 100 amino acids)
AKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTAAASPAGLDLSNGHLDTFRLSLARFWEQSAPTGPPVSTPGPPDDDEEEGAPTTPQAEGAMESS

Format: Rabbit Whole Serum.

Preservative: 0.05 % NaN3

Quantity: 100 µL

Specificity: This antibody detects human ZBTB7B protein. Other species have not been tested.
 
Application: Western blotting (1 : 1,000), Other applications have not been tested.


For research use only, not for diagnostic use

Related Products

Recently Viewed

Satisfaction
Quality Rating
Value Rating
Style Rating

X