Anti-TAF7, Human, Rabbit-Poly
Cat. No.:
FNK-KB5274GNP
Size: 100μL
Storage: -20°C. Avoid freeze-thaw cycles.
Antigen Species: Human
Host Species: Rabbit
Cross Reactivity: Human
Label: Unlabeled
Purification: Serum
Specifications
Gene: TAF7 (Transcription initiation factor TFIID subunit 7, Transcription initiation factor TFIID 55 kDa subunit, TAF(II55, TAFII-55, TAFII55, RNA polymerase II TBP-associated factor subunit F)
Immunogen: GX5105 (GST-fusion protein, 158 amino acids)
DDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVE
Format: Rabbit Whole Serum.
Preservative: 0.05 % NaN3
Quantity: 100 µL
Specificity: This antibody detects human TAF7 protein. Other species have not been tested.
Application: Western blotting (1 : 1,000), Other applications have not been tested.
For research use only, not for diagnostic use
