Anti-Mouse TOMM70A (KIAA0719) Polyclonal Antibody, Rabbit
Product#: FNK-MKA0719AF
$495.39
Availability:
Ships in 1-2 Weeks
Anti-Mouse TOMM70A (KIAA0719) Polyclonal Antibody, Rabbit
General information
| Cat. No. | ：FNK-MKA0719AF |
| Quantity | ：50 µg (250 µL) |
| Gene | ：mouse translocase of outer mitochondrial membrane 70 homolog A (mTOMM70A, mKIAA0719) |
| Immunogen | ：GX0242 (GST-fusion protein, 163 amino acids) YRQAYTANNSSQVQAAMKGFEEIIKKFPRCAEGYALYAQALTDQQQFGKADEMYDKCIDLEPD NATTYVHKGLLQLQWKQDLDKGLELISKAIEIDNKCDFAYETMGTIEVQRGNMEKAIDMFNKAIN LAKSEMEMAHLYSLCDAAHAQTEVAKKYGLKPPTL |
| Format | ：Affinity Purified Rabbit IgG |
| Constitution | ：PBS containing with 50% glycerol and 0.02% of NaN3 |
| Antigen Species | ：Mouse |
| Host Species | ：Rabbit |
| Label | ：Unlabeled |
| Cross Reactivity | ：Human/ Mouse |
| Application | ：Western blotting (1 : 1,000), Other applications have not been tested. |
| Specificity |
：Specific to recombinant protein GX0242. This antibody detects mTOMM70A protein. It also recognizes
human TOMM70A protein. Other species have not been tested. |
| Storage | ：Store at -20°C. Avoid freeze-thaw cycles. |
References
- Okazaki,N. et al.: DNA Res., 10(1), 35 (2003).
Aliases for TOMM70 Gene
- Translocase Of Outer Mitochondrial Membrane 70 2 3 5
- Translocase Of Outer Mitochondrial Membrane Protein 70 3 4
- Mitochondrial Precursor Proteins Import Receptor 3 4
- Translocase Of Outer Membrane 70 KDa Subunit 3 4
- Mitochondrial Import Receptor Subunit TOM70 3 4
- KIAA0719 2 4
- TOMM70A 3 4
- Tom70 2 3
- Translocase Of Outer Mitochondrial Membrane 70 Homolog A (S. Cerevisiae) 2
- Translocase Of Outer Mitochondrial Membrane 70 (Yeast) Homolog A 2
- Translocase Of Outer Mitochondrial Membrane 70 Homolog A (Yeast) 2
- Translocase Of Outer Mitochondrial Membrane 70 Homolog A 3
- TOMM70 5
- TOM70 4
